Crystal structure of circumsporozoite protein aTSR domain, P43212 form. Determined by X-ray diffraction at 2.04 Å resolution. Released 9 May 2012.
Explore 3VDL in 3D Show helices and sheets RCSB PDB PDBe
3VDL contains 18 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 313-322 | 10 | |
| α-helix | 331-334 | 4 | |
| β-strand | 340-346 | 7 | 1 |
| α-helix | 348-350 | 3 | |
| α-helix | 355-357 | 3 | |
| α-helix | 360-363 | 4 | |
| β-strand | 364-370 | 7 | 1 |
| α-helix | 373-375 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 313-323 | 11 | |
| α-helix | 331-334 | 4 | |
| β-strand | 340-346 | 7 | 3 |
| α-helix | 348-350 | 3 | |
| α-helix | 355-357 | 3 | |
| α-helix | 360-363 | 4 | |
| β-strand | 364-370 | 7 | 3 |
| α-helix | 373-375 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Circumsporozoite (CS) protein | A, B, C | protein | 77 | Plasmodium falciparum | Q7K740 (AlphaFold model) |
>3VDL_1 Circumsporozoite (CS) protein (chains A, B, C) YVEFEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIE KKICKMEKCPHHHHHHA
Unexpected fold in the circumsporozoite protein target of malaria vaccines. Doud, M.B., Koksal, A.C., Mi, L.Z. et al. Proc Natl Acad Sci U S A (2012) 109:7817-7822. DOI 10.1073/pnas.1205737109 · PubMed
Other PDB entries of the same protein (UniProt Q7K740 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3VDL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.