Crystal structure of Saccharomyces cerevisiae Atg7 (1-595). Determined by X-ray diffraction at 3.0 Å resolution. Released 21 Sept 2011.
Explore 3VH1 in 3D Show helices and sheets RCSB PDB PDBe
3VH1 contains 24 α-helices and 35 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-6 | 2 | 1 |
| α-helix | 7-8 | 2 | |
| β-strand | 10 | 1 | 2 |
| β-strand | 13-17 | 5 | 3 |
| α-helix | 19-30 | 12 | |
| β-strand | 39-46 | 8 | 4 |
| β-strand | 57 | 1 | 5 |
| β-strand | 58-62 | 5 | 3 |
| β-strand | 78-87 | 10 | 4 |
| α-helix | 90-94 | 5 | |
| α-helix | 98-113 | 16 | |
| α-helix | 117-119 | 3 | |
| β-strand | 123-130 | 8 | 4 |
| β-strand | 135-146 | 12 | 4 |
| β-strand | 153-158 | 6 | 1 |
| α-helix | 162-174 | 13 | |
| β-strand | 180-183 | 4 | 1 |
| β-strand | 189-191 | 3 | 1 |
| α-helix | 194-200 | 7 | |
| β-strand | 202-206 | 5 | 1 |
| β-strand | 209 | 1 | 5 |
| β-strand | 216 | 1 | 2 |
| α-helix | 219-229 | 11 | |
| β-strand | 235-241 | 7 | 1 |
| β-strand | 248-254 | 7 | 1 |
| β-strand | 269-273 | 5 | 4 |
| α-helix | 274-276 | 3 | |
| β-strand | 284-287 | 4 | 4 |
| α-helix | 289-292 | 4 | |
| α-helix | 294-313 | 20 | |
| α-helix | 319-323 | 5 | |
| α-helix | 325 | 1 | |
| β-strand | 326-330 | 5 | 6 |
| α-helix | 334-344 | 11 | |
| β-strand | 350-354 | 5 | 6 |
| β-strand | 358 | 1 | 7 |
| β-strand | 378 | 1 | 7 |
| α-helix | 379-390 | 12 | |
| β-strand | 395-399 | 5 | 6 |
| α-helix | 403-405 | 3 | |
| α-helix | 413-429 | 17 | |
| β-strand | 432-435 | 4 | 6 |
| β-strand | 439 | 1 | 8 |
| α-helix | 440-442 | 3 | |
| α-helix | 444-452 | 9 | |
| β-strand | 456-462 | 7 | 6 |
| β-strand | 466-472 | 7 | 6 |
| β-strand | 483 | 1 | 9 |
| β-strand | 505 | 1 | 8 |
| α-helix | 513-530 | 18 | |
| α-helix | 532-534 | 3 | |
| β-strand | 539-540 | 2 | 10 |
| β-strand | 543-544 | 2 | 10 |
| β-strand | 548-552 | 5 | 6 |
| β-strand | 557-561 | 5 | 6 |
| β-strand | 564 | 1 | 9 |
| α-helix | 565-566 | 2 | |
| α-helix | 574-583 | 10 | |
| α-helix | 585-593 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-like modifier-activating enzyme ATG7 | A | protein | 598 | Saccharomyces cerevisiae | P38862 (AlphaFold model) |
>3VH1_1 Ubiquitin-like modifier-activating enzyme ATG7 (chains A) GPHMSSERVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQ VPLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDI NKCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYS KWVCILDADDEIVNYDKCIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFK LLIIRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLSSLLDPLKI ADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNG TVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEEAQH KDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVMRHGNRDE QSSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGS ETTVLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKKALEHP
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Structural basis of Atg8 activation by a homodimeric E1, Atg7. Noda, N.N., Satoo, K., Fujioka, Y. et al. Mol Cell (2011) 44:462-475. DOI 10.1016/j.molcel.2011.08.035 · PubMed
Other PDB entries of the same protein (UniProt P38862 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3VH1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.