4GSJ: Atg7 NTD K14A F16A D18A mutant

Crystal structure of Atg7 NTD K14A F16A D18A mutant. Determined by X-ray diffraction at 1.7 Å resolution. Released 14 Nov 2012.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 2,623
Mol. weight: 33.8 kDa
Ligands: IPA, CIT
Released: 14 Nov 2012

Explore 4GSJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GSJ contains 11 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	1
β-strand	10	1	2
β-strand	13-17	5	3
α-helix	19-29	11
β-strand	37-46	10	4
β-strand	57	1	5
β-strand	58-62	5	3
α-helix	64-67	4
α-helix	69-70	2
β-strand	78-87	10	4
α-helix	90-95	6
α-helix	98-113	16
α-helix	117-119	3
β-strand	123-130	8	4
β-strand	135-146	12	4
β-strand	151-157	7	1
α-helix	159-164	6
α-helix	165-174	10
β-strand	180-183	4	1
β-strand	189-191	3	1
α-helix	194-200	7
β-strand	202-206	5	1
β-strand	209	1	5
β-strand	216	1	2
α-helix	218-229	12
β-strand	235-241	7	1
β-strand	248-256	9	1
β-strand	269-273	5	4
α-helix	274-275	2
β-strand	284-287	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like modifier-activating enzyme ATG7	A	protein	291	Saccharomyces cerevisiae	P38862 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4GSJ_1 Ubiquitin-like modifier-activating enzyme ATG7 (chains A)
GSMSSERVLSYAPAFASALATSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQV
PLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDIN
KCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYSK
WVCILDADDEIVNYDKCIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFKL
LIIRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLS

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	6
CIT	Citric acid	C6 H8 O7	1

Primary citation

Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Kaiser, S.E., Mao, K., Taherbhoy, A.M. et al. Nat Struct Mol Biol (2012) 19:1242-1249. DOI 10.1038/nsmb.2415 · PubMed

Other PDB entries of the same protein (UniProt P38862 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3T7H 1.6 Å, Atg8 transfer from Atg7 to Atg3: a distinctive E1-E2 architecture and mechanism in the…
3T7F 1.89 Å, Atg8 transfer from Atg7 to Atg3: a distinctive E1-E2 architecture and mechanism in the…
3RUI 1.91 Å, Crystal structure of Atg7C-Atg8 complex
3VH3 2.0 Å, Crystal structure of Atg7CTD-Atg8 complex
3T7G 2.08 Å, Atg8 transfer from Atg7 to Atg3: a distinctive E1-E2 architecture and mechanism in the…
3RUJ 2.1 Å, Crystal Structure of N-terminal region of yeast Atg7
5YEC 2.15 Å, Crystal structure of Atg7CTD-Atg8-MgATP complex in form II
3T7E 2.25 Å, Atg8 transfer from Atg7 to Atg3: a distinctive E1-E2 architecture and mechanism in the…
3VH4 2.65 Å, Crystal structure of Atg7CTD-Atg8-MgATP complex
4GSL 2.7 Å, Crystal structure of an Atg7-Atg3 crosslinked complex
4GSK 2.9 Å, Crystal structure of an Atg7-Atg10 crosslinked complex
3VH1 3.0 Å, Crystal structure of Saccharomyces cerevisiae Atg7 (1-595)

Browse structure collections

About this viewer

MolViewer shows 4GSJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.