3VKH: Functional full-length dynein motor domain

X-ray structure of a functional full-length dynein motor domain. Determined by X-ray diffraction at 3.8 Å resolution. Released 14 Mar 2012.

Method: X-ray diffraction
Resolution: 3.8 Å
Organism: Dictyostelium discoideum
Chains: 2
Atoms: 45,974
Mol. weight: 772.08 kDa
Ligands: ADP
Released: 14 Mar 2012

Explore 3VKH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VKH contains 296 α-helices and 158 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 157 helices, 81 β-strands

Element	Residues	Length	Sheet
α-helix	1513-1537	25
β-strand	1542	1	1
β-strand	1545-1548	4	2
β-strand	1552-1555	4	2
α-helix	1558-1574	17
α-helix	1575-1577	3
α-helix	1585-1616	32
α-helix	1626-1628	3
α-helix	1630-1652	23
β-strand	1655	1	1
α-helix	1656-1659	4
α-helix	1665-1693	29
α-helix	1695-1699	5
α-helix	1702-1710	9
α-helix	1716-1719	4
α-helix	1722-1724	3
β-strand	1729-1734	6	3
β-strand	1740-1746	7	3
β-strand	1751-1759	9	3
α-helix	1766-1792	27
α-helix	1800-1807	8
α-helix	1812-1829	18
β-strand	1833	1	4
α-helix	1838-1862	25
α-helix	1869-1892	24
β-strand	1900	1	4
α-helix	1904-1907	4
β-strand	1910-1913	4	5
β-strand	1926-1929	4	5
β-strand	1932-1935	4	5
α-helix	1951-1964	14
β-strand	1969-1973	5	6
α-helix	1980-1990	11
β-strand	1995-1999	5	6
α-helix	2006-2015	10
α-helix	2016-2020	5
β-strand	2022-2026	5	6
α-helix	2028-2030	3
α-helix	2033-2050	18
β-strand	2056-2057	2	7
β-strand	2065-2066	2	7
β-strand	2072-2075	4	6
β-strand	2077	1	6
β-strand	2081	1	8
β-strand	2084	1	8
β-strand	2095-2099	5	6
α-helix	2105-2114	10
α-helix	2121-2135	15
α-helix	2149-2163	15
α-helix	2178-2202	25
α-helix	2211-2222	12
α-helix	2234-2246	13
α-helix	2253-2266	14
β-strand	2271-2273	3	9
α-helix	2282-2296	15
β-strand	2301-2303	3	9
α-helix	2313-2316	4
β-strand	2319-2321	3	10
β-strand	2326-2328	3	10
α-helix	2331-2340	10
α-helix	2346-2348	3
β-strand	2350-2355	6	9
α-helix	2365-2367	3
α-helix	2368-2371	4
β-strand	2376	1	11
β-strand	2386	1	11
β-strand	2391-2395	5	9
β-strand	2412-2413	2	9
α-helix	2418-2420	3
α-helix	2423-2434	12
α-helix	2441-2448	8
α-helix	2490-2506	17
α-helix	2511-2521	11
β-strand	2524	1	12
α-helix	2530-2551	22
α-helix	2562-2580	19
β-strand	2585	1	12
α-helix	2587-2600	14
α-helix	2612-2614	3
β-strand	2615	1	13
β-strand	2626	1	13
β-strand	2637	1	14
β-strand	2640	1	14
α-helix	2651-2665	15
β-strand	2671-2673	3	15
α-helix	2680-2687	8
α-helix	2688-2690	3
β-strand	2694-2699	6	15
α-helix	2707-2714	8
β-strand	2718-2721	4	16
β-strand	2729-2732	4	16
β-strand	2738-2743	6	15
α-helix	2758-2764	7
α-helix	2765-2769	5
β-strand	2771-2774	4	16
β-strand	2779-2783	5	16
β-strand	2786-2792	7	15
α-helix	2805-2808	4
β-strand	2813	1	15
α-helix	2821-2835	15
α-helix	2840-2842	3
α-helix	2846-2863	18
α-helix	2876-2890	15
α-helix	2898-2913	16
α-helix	2920-2937	18
α-helix	2943-2946	4
α-helix	2947	1
β-strand	2952-2953	2	17
β-strand	2961-2962	2	17
α-helix	2965-2982	18
α-helix	2992-3005	14
β-strand	3012-3015	4	18
β-strand	3016	1	19
α-helix	3022-3032	11
β-strand	3036-3038	3	18
α-helix	3048-3063	16
β-strand	3069-3074	6	18
α-helix	3075-3077	3
α-helix	3082-3093	12
α-helix	3103-3118	16
α-helix	3126-3138	13
β-strand	3143-3147	5	18
α-helix	3156-3159	4
α-helix	3164-3166	3
β-strand	3169	1	18
β-strand	3174	1	19
α-helix	3178-3186	9
α-helix	3203-3209	7
α-helix	3223-3248	26
α-helix	3257-3321	65
α-helix	3323-3334	12
α-helix	3336-3339	4
α-helix	3342-3346	5
α-helix	3350-3354	5
α-helix	3356-3365	10
α-helix	3366-3368	3
α-helix	3372-3381	10
α-helix	3385-3393	9
α-helix	3399-3411	13
α-helix	3419-3424	6
α-helix	3425-3427	3
α-helix	3431-3436	6
α-helix	3445-3449	5
α-helix	3450-3452	3
α-helix	3453-3457	5
α-helix	3464-3470	7
α-helix	3474-3488	15
α-helix	3515-3517	3
α-helix	3518-3532	15
α-helix	3536-3598	63
α-helix	3602-3604	3
α-helix	3607-3624	18
α-helix	3634-3637	4
α-helix	3641-3649	9
α-helix	3656-3664	9
β-strand	3672-3675	4	20
α-helix	3680-3688	9
β-strand	3698	1	21
α-helix	3703-3714	12
β-strand	3717	1	22
β-strand	3720	1	20
β-strand	3721	1	21
α-helix	3723-3725	3
β-strand	3761	1	22
β-strand	3764-3765	2	20
α-helix	3775-3779	5
β-strand	3782-3785	4	20
α-helix	3790-3802	13
α-helix	3808-3836	29
α-helix	3845-3847	3
α-helix	3850-3862	13
α-helix	3864-3867	4
α-helix	3869-3884	16
α-helix	3887-3901	15
α-helix	3903-3905	3
α-helix	3913-3924	12
α-helix	3936-3955	20
α-helix	3961-3975	15
α-helix	3982-3984	3
α-helix	3988-3992	5
α-helix	4006-4008	3
α-helix	4014-4025	12
α-helix	4028-4030	3
α-helix	4033-4039	7
α-helix	4041-4048	8
α-helix	4060-4067	8
α-helix	4075-4089	15
α-helix	4094-4106	13
α-helix	4118-4124	7
β-strand	4132-4136	5	23
α-helix	4143-4151	9
β-strand	4161	1	24
α-helix	4165-4167	3
α-helix	4168-4177	10
α-helix	4178-4182	5
β-strand	4188	1	24
α-helix	4190-4192	3
α-helix	4197-4204	8
β-strand	4216-4220	5	23
α-helix	4227-4231	5
α-helix	4244-4253	10
α-helix	4257-4260	4
α-helix	4267-4283	17
α-helix	4284-4287	4
α-helix	4300-4316	17
α-helix	4326-4328	3
α-helix	4331-4337	7
α-helix	4339-4343	5
α-helix	4344-4346	3
α-helix	4350-4363	14
α-helix	4366-4369	4
β-strand	4374-4376	3	25
β-strand	4381-4382	2	25
α-helix	4389-4397	9
α-helix	4414-4430	17
α-helix	4458-4461	4
α-helix	4496-4517	22
α-helix	4518-4520	3
α-helix	4533-4536	4
α-helix	4540-4542	3
α-helix	4548-4550	3
α-helix	4561-4580	20
α-helix	4591-4593	3
α-helix	4597-4609	13
β-strand	4636-4639	4	26
β-strand	4642-4645	4	27
β-strand	4648-4650	3	28
β-strand	4653-4655	3	28
β-strand	4661-4664	4	27
β-strand	4667-4670	4	26
α-helix	4681-4683	3
β-strand	4686-4691	6	27
β-strand	4693	1	29
β-strand	4699-4705	7	27
β-strand	4707	1	28
α-helix	4713-4717	5
β-strand	4722-4724	3	27
β-strand	4726	1	29

Chain B: 139 helices, 77 β-strands

Element	Residues	Length	Sheet
α-helix	1479-1486	8
α-helix	1499-1504	6
α-helix	1511-1538	28
β-strand	1542	1	30
β-strand	1544-1548	5	31
β-strand	1552-1556	5	31
α-helix	1558-1574	17
α-helix	1581-1618	38
α-helix	1630-1651	22
β-strand	1655	1	30
α-helix	1656-1659	4
α-helix	1665-1693	29
α-helix	1695-1699	5
α-helix	1702-1710	9
α-helix	1715-1718	4
α-helix	1719-1721	3
α-helix	1722-1725	4
β-strand	1729-1734	6	32
β-strand	1740-1746	7	32
β-strand	1751-1759	9	32
α-helix	1766-1793	28
α-helix	1800-1807	8
α-helix	1812-1831	20
α-helix	1838-1860	23
α-helix	1862-1864	3
α-helix	1869-1894	26
α-helix	1904-1907	4
β-strand	1910-1914	5	33
β-strand	1925-1929	5	33
β-strand	1932-1935	4	33
α-helix	1951-1964	14
β-strand	1969-1973	5	34
α-helix	1980-1990	11
β-strand	1995-1999	5	34
α-helix	2006-2018	13
β-strand	2022-2026	5	34
α-helix	2028-2030	3
α-helix	2033-2051	19
β-strand	2056	1	35
β-strand	2066	1	35
β-strand	2072-2075	4	34
β-strand	2077	1	34
α-helix	2089-2091	3
β-strand	2095-2099	5	34
α-helix	2105-2116	12
α-helix	2121-2138	18
α-helix	2149-2163	15
α-helix	2187-2202	16
α-helix	2204-2206	3
α-helix	2209-2211	3
α-helix	2212-2222	11
α-helix	2234-2244	11
α-helix	2253-2265	13
β-strand	2271-2273	3	36
α-helix	2282-2296	15
β-strand	2300-2303	4	37
β-strand	2306	1	36
α-helix	2313-2317	5
β-strand	2320	1	38
β-strand	2327	1	38
α-helix	2331-2340	10
α-helix	2346-2348	3
β-strand	2349-2352	4	37
β-strand	2353-2355	3	36
α-helix	2363-2365	3
α-helix	2368-2371	4
β-strand	2376-2377	2	39
β-strand	2385-2386	2	39
β-strand	2393-2395	3	36
α-helix	2405-2407	3
β-strand	2412-2413	2	36
α-helix	2418-2420	3
α-helix	2423-2436	14
α-helix	2492-2501	10
α-helix	2511-2519	9
β-strand	2524	1	40
α-helix	2530-2549	20
α-helix	2551-2554	4
α-helix	2559-2561	3
α-helix	2564-2580	17
β-strand	2585	1	40
α-helix	2587-2598	12
α-helix	2612-2614	3
β-strand	2615-2617	3	41
β-strand	2624-2626	3	41
α-helix	2627-2629	3
α-helix	2651-2663	13
β-strand	2671-2673	3	42
α-helix	2680-2689	10
β-strand	2694-2697	4	42
β-strand	2700	1	42
α-helix	2707-2712	6
β-strand	2718-2723	6	43
β-strand	2727-2732	6	43
β-strand	2738-2744	7	42
α-helix	2758-2768	11
β-strand	2771-2774	4	43
β-strand	2779-2783	5	43
β-strand	2786-2792	7	42
α-helix	2800-2804	5
α-helix	2805-2808	4
β-strand	2813	1	42
α-helix	2821-2835	15
α-helix	2841-2843	3
α-helix	2846-2863	18
α-helix	2876-2891	16
α-helix	2898-2913	16
α-helix	2920-2937	18
β-strand	2952-2953	2	44
β-strand	2961-2962	2	44
α-helix	2965-2982	18
α-helix	2992-3005	14
β-strand	3012	1	45
β-strand	3015-3016	2	46
α-helix	3022-3032	11
α-helix	3035	1
β-strand	3036-3038	3	45
α-helix	3048-3063	16
β-strand	3069-3074	6	45
α-helix	3082-3092	11
α-helix	3104-3117	14
α-helix	3127-3137	11
β-strand	3141-3146	6	45
β-strand	3147	1	46
α-helix	3156-3160	5
α-helix	3164-3167	4
β-strand	3172-3174	3	46
α-helix	3178-3187	10
α-helix	3203-3209	7
α-helix	3223-3249	27
α-helix	3257-3341	85
α-helix	3343-3346	4
α-helix	3348-3355	8
α-helix	3513-3575	63
α-helix	3578-3600	23
α-helix	3602-3604	3
α-helix	3607-3624	18
α-helix	3634-3637	4
α-helix	3641-3648	8
α-helix	3656-3664	9
β-strand	3672-3675	4	47
α-helix	3680-3688	9
β-strand	3695-3698	4	47
α-helix	3703-3710	8
α-helix	3711-3715	5
β-strand	3718-3721	4	47
α-helix	3723-3725	3
α-helix	3728-3730	3
α-helix	3731-3734	4
β-strand	3762-3766	5	47
α-helix	3775-3778	4
β-strand	3782-3785	4	47
α-helix	3790-3805	16
α-helix	3807-3837	31
α-helix	3850-3902	53
α-helix	3903-3905	3
α-helix	3913-3924	12
α-helix	3928-3931	4
α-helix	3936-3955	20
α-helix	3963-3973	11
α-helix	3982-3984	3
α-helix	3985-3992	8
α-helix	4006-4008	3
α-helix	4014-4025	12
α-helix	4028-4030	3
α-helix	4033-4039	7
α-helix	4041-4044	4
α-helix	4060-4068	9
α-helix	4075-4089	15
α-helix	4094-4106	13
α-helix	4114-4116	3
α-helix	4118-4123	6
β-strand	4132-4136	5	48
α-helix	4143-4152	10
β-strand	4157-4161	5	48
α-helix	4166-4181	16
β-strand	4184-4188	5	48
α-helix	4194-4205	12
β-strand	4214-4220	7	48
α-helix	4227-4231	5
β-strand	4234-4238	5	48
α-helix	4244-4252	9
α-helix	4257-4260	4
α-helix	4266-4283	18
α-helix	4284-4286	3
α-helix	4300-4316	17
α-helix	4326-4328	3
α-helix	4331-4337	7
α-helix	4338-4342	5
α-helix	4350-4363	14
α-helix	4366-4369	4
β-strand	4374-4376	3	49
β-strand	4381-4382	2	49
α-helix	4389-4396	8
α-helix	4414-4432	19
α-helix	4458-4462	5
α-helix	4494-4521	28
α-helix	4532-4543	12
α-helix	4548-4550	3
α-helix	4561-4580	20
β-strand	4589	1	50
α-helix	4591-4593	3
α-helix	4597-4612	16
β-strand	4619	1	51
β-strand	4637-4639	3	50
β-strand	4643-4645	3	52
β-strand	4648-4649	2	53
β-strand	4654-4655	2	53
β-strand	4663	1	52
β-strand	4667-4669	3	50
β-strand	4673	1	51
β-strand	4686-4691	6	52
β-strand	4699-4705	7	52
β-strand	4707	1	53
α-helix	4713-4719	7
β-strand	4722-4724	3	52

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein heavy chain, cytoplasmic	A, B	protein	3367	Dictyostelium discoideum	P34036

Sequence of entity 1 (A, B), FASTA

>3VKH_1 Dynein heavy chain, cytoplasmic (chains A, B)
MTRHHHHHHGGGDYKDDDDKGGGKVPVEEEIQDLKAVWVELSNTWQEIDSLKETAWSAII
PRKVRKSLEDTLQKLKNLPNRIRQYSAFDHAQNLIKIYLKGNAIITDLHSEAIKDRHWKI
LKKRLNTNWIITELTLGSIWDSDLARNENIYREVITAAQGEIALEEFLKGVREFWTTLEL
DLVNYQRKCKLVRGWDDLFNKLAEHLNSISAMKMSPYYKVFEEEANHWDDRLNKVRSLLD
VWIDVQRRWVYLEGIFSGSGDINQLLPAESTRFKSINSEFIAILKKVSGAPLILEVLAIE
RIQQTMERLSDLLGKVQKALGEYLERQRSAFARFYFVGDEDLLEIIGNSKDIIKIQKHFR
KMFAGLANLTLDDEKTTIIGMSSAEGETVTFKKPISIANGPKIHEWLTMVESEMKSTLAT
LLSESLQHFNQVDVNDHSKYSEWVDNYPTQLVLLTSQIVWSTQVDQALGGGTLQQSKIQE
QLQSIEQTTQMILNNLADSVLQDLSAQKRKKFEHLITELVHQRDVVRQLQKCKNLTGNKD
FDWLYHMRYYYDATQENVLHKLVIHMANATFYYGFEYLGIGERLVQTPLTDRCYLTLTQA
LESRMGGNPFGPAGTGKTETVKALGSQLGRFVLVFCCDEGFDLQAMSRIFVGLCQCGAWG
CFDEFNRLEERILSAVSQQIQTIQVALKENSKEVELLGGKNISLHQDMGIFVTMNPGYAG
RSNLPDNLKKLFRSMAMIKPDREMIAQVMLYSQGFKTAEVLAGKIVPLFKLCQEQLSAQS
HYDFGLRALKSVLVSAGGIKRKCQPPQLPPITDAESKTKADQIYCQYEIGVLLNSINDTM
IPKLVADDIPLIQSLLLDVFPGSQLQPIQMDQLRKKIQEIAKQRHLVTKQEWVEKILQLH
QILNINHGVMMVGPSGGGKTTSWEVYLEAIEQVDNIKSEAHVMDPKAITKDQLFGSLDLT
TREWTDGLFTATLRRIIDNVRGESTKRHWIIFDGDVDPEWVENLNSLLDDNKLLTLPNGE
RLALPNNVRVMFEVQDLKYATLATISRCGMVWFSEEILTTQMIFQNYLDTLSNEPFDPQE
KEQQKRNENAQLQQQQQTTITSPILTSPPTTSSSSRSTTSTTSMIPAGLKVQKECAAIIS
QYFEPGGLVHKVLEDAGQRPHIMDFTRLRVLNSFFSLMNRSIVNVIEYNQLHSDFPMSPE
NQSNYITNRLLYSLMWGLGGSMGLVERENFSKFIQTIAITPVPANTIPLLDYSVSIDDAN
WSLWKNKVPSVEVETHKVASPDVVIPTVDTTRHVDVLHAWLSEHRPLILCGPPGSGKTMT
LTSTLRAFPDFEVVSLNFSSATTPELLLKTFDHHCEYKRTPSGETVLRPTQLGKWLVVFC
DEINLPSTDKYGTQRVITFIRQMVEKGGFWRTSDHTWIKLDKIQFVGACNPPTDAGRVQL
THRFLRHAPILLVDFPSTSSLTQIYGTFNRALMKLLPNLRSFADNLTDAMVEFYSESQKR
FTPDIQAHYIYSPRELSRWDRALLEAIQTMDGCTLEGLVRLWAHEALRLFQDRLVETEEK
EWTDKKIDEVALKHFPSVNLDALKRPILYSNWLTKDYQPVNRSDLREYVKARLKVFYEEE
LDVPLVLFNEVLDHILRIDRVFRQPQGHALLIGVSGGGKSVLSRFVAWMNGLSIYTIKVN
NNYKSSDFDDDLRMLLKRAGCKEEKICFIFDESNVLESSFLERMNTLLAGGEVPGLFEGE
EFTALMHACKETAQRNGLILDSEEELYKYFTSQVRRNLHVVFTMNPASPDFHNRSATSPA
LFNRCVLDWFGEWSPEALFQVGSEFTRNLDLENPQYIAPPVFIQEAEIMGNNLMAIPPSH
RDAVVSSLVYIHQTIGEANIRLLKRQGRQNYVTPRHYLDFINQVVLLINEKRDQLEEEQL
HLNIGLKKLRDTEAQVKDLQVSLAQKNRELDVKNEQANQKLKQMVQDQQAAEIKQKDARE
LQVQLDVRNKEIAVQKVKAYADLEKAEPAIIEAQEAVSTIKKKHLDEIKSLPKPPTPVKL
AMEAVCLMLGGKKLEWADIRKKIMEPNFITSIINYDTKKMMTPKIREAITKGYLEDPGFD
YETVNRASKACGPLVKWATAQTYYSEILDRIKPLREEVEQLENAANELKLKQDEIVATIT
ALEKSIATYKEEYATLIRETEQIKTESSKVKNKVDRSIALLDNLNSERGRWEQQSENFNT
QMSTVVGDVVLASAFLAYIGFFDQNFRTDLMRKWMIRLDSVGIKFKSDLSVPSFLSKPEE
RLNWHANSLPSDELCIENAIMLKRFNRYPLVIDPSGQAMEFLMNQYADKKITKTSFLDSS
FMKNLESALRFGCPLLVQDVENIDPVLNPVLNKEIRKKGGRILIRLGDQDVDFSPSFMIF
LFTRDPTAHFTPDLCSRVTFVNFTVTPSSLQSQCLHEALKTERPDTHKKRSDLLKIQGEF
QVKLRILEKSLLNALSQASGNILDDDSVISTLETLKKETTEIALKVEETETVMQEISEVS
ALYNPMALSCSRVYFAMEELSQFHLYQFSLRAFLDIFYNLLNNNPNLVDKKDPNERLVYL
SKDIFSMTFNRVTRTLLNDDKLTFALQLTIISVKGTSNEIEESEWDFLLKGGDNLTSIKE
TIPQLDSLLSTTQQKWLICLRQQVPSFSKLVDHIQQNSSDWKQFFGKDQVGEPIIPESWI
VAQAQLSNQQSTIVSNFRKILLMKAFHSDRVLQYSHSFVCSVFGEDFLNTQELDMANIVE
KEVKSSSPLLLCSVPGYDASSKVDDLALQLHKQYKSFAIGSPEGFELAEKSIYAAAKSGT
WVLLKNIHLAPQWLVQLEKKLHSLSPHPSFRLFMTSEIHPALPANLLRMSNVFSYENPPG
VKANLLHTFIGIPATRMDKQPAERSRIYFLLAWFHAIIQERLRYIPLGWTKFFEFNDADL
RGALDSIDYWVDLYSKGRSNIDPDKIPWIAVRTILGSTIYGGRIDNEFDMRLLYSFLEQL
FTPSAFNPDFPLVPSIGLSVPEGTTRAHFMKWIEALPEISTPIWLGLPENAESLLLSNKA
RKMINDLQKMQSSEEDGEDDQVSGSSKKESSSSSSEDKGKAKLRATITEWTKLLPKPLKQ
LKRTTQNIKDPLFRCFEREISTGGKLVKKITNDLANLLELISGNIKSTNYLRSLTTSISK
GIVPKEWKWYSVPETISLSVWISDFSKRMQQLSEISESSDYSSIQVWLGGLLNPEAYITA
TRQSASQLNGWSLENLRLHASSLGKISSEGGASFNVKGMALEGAVWNNDQLTPTDILSTP
ISIATLTWKDKDDPIFNNSSSKLSVPVYLNETRSELLFSIDLPYDQSTSKQNWYQRSVSI
SSWKSDI

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	8

Primary citation

The 2.8 A crystal structure of the dynein motor domain. Kon, T., Oyama, T., Shimo-Kon, R. et al. Nature (2012) 484:345-350. DOI 10.1038/nature10955 · PubMed

Other PDB entries of the same protein (UniProt P34036), best resolution first:

27PT 2.2 Å, Dictyostelium discoideum cytoplasmic dynein motor domain in complex with ADP.Vi…
27PY 2.61 Å, Dictyostelium discoideum cytoplasmic dynein motor domain in the presence of ADP (ADP…
27QB 2.66 Å, Dictyostelium discoideum cytoplasmic dynein motor domain in the absence of nucleotide…
27QA 2.76 Å, Dictyostelium discoideum cytoplasmic dynein motor domain in the presence of ADP (Apo…
3VKG 2.81 Å, X-ray structure of an MTBD truncation mutant of dynein motor domain
27PZ 3.2 Å, Dictyostelium discoideum cytoplasmic dynein motor domain in the presence of ADP (ADP…
3J6P 8.2 Å, Pseudo-atomic model of dynein microtubule binding domain-tubulin complex based on a…

Browse more

3VKH is part of these collections:

Motor proteins and the cytoskeleton

About this viewer

MolViewer shows 3VKH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.