3W30: ORF169b

Structual basis for the recognition of Ubc13 by the Shigella flexneri effector OspI. Determined by X-ray diffraction at 2.99 Å resolution. Released 27 Mar 2013.

Method: X-ray diffraction
Resolution: 2.99 Å
Organism: Shigella flexneri
Chains: 2
Atoms: 2,980
Mol. weight: 48.24 kDa
Released: 27 Mar 2013

Explore 3W30 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3W30 contains 28 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	24-32	9
α-helix	38-53	16
α-helix	63-73	11
β-strand	79	1	1
α-helix	80-82	3
α-helix	84-86	3
α-helix	91-93	3
α-helix	96-98	3
α-helix	99-102	4
β-strand	107-108	2	2
β-strand	114	1	3
α-helix	115-129	15
β-strand	135-140	6	2
β-strand	145-151	7	2
β-strand	156-159	4	2
β-strand	160	1	4
β-strand	165	1	4
β-strand	180	1	3
α-helix	181-182	2
β-strand	186-190	5	2
α-helix	194-201	8
α-helix	204-207	4
α-helix	210	1
β-strand	211	1	1

Chain B: 15 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	24-32	9
α-helix	38-53	16
α-helix	63-73	11
β-strand	79	1	5
α-helix	80-83	4
α-helix	84-86	3
α-helix	91-93	3
α-helix	96-98	3
α-helix	99-103	5
β-strand	107-108	2	6
α-helix	109-110	2
β-strand	114	1	7
α-helix	115-127	13
β-strand	135-140	6	6
β-strand	145-151	7	6
β-strand	156-159	4	6
β-strand	160	1	8
β-strand	165	1	8
α-helix	179	1
β-strand	180	1	7
α-helix	181-182	2
β-strand	186-190	5	6
α-helix	194-201	8
α-helix	204-207	4
α-helix	210	1
β-strand	211	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ORF169b	A, B	protein	220	Shigella flexneri	Q8VSD5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3W30_1 ORF169b (chains A, B)
GPLGSPEFMINGVSLQGTAGYEAHTEEGNVNVKKLLESLNSKSLGDMDKDSELAATLQKM
INPSGGDGNASGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPN
ETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDP
VEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC

Primary citation

Structural Basis for the Recognition of Ubc13 by the Shigella flexneri Effector OspI. Nishide, A., Kim, M., Takagi, K. et al. J Mol Biol (2013) 425:2623-2631. DOI 10.1016/j.jmb.2013.02.037 · PubMed

Other PDB entries of the same protein (UniProt Q8VSD5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3B21 2.01 Å, Crystal structure of OspI from Shigella flexineri
4XZX 2.2 Å, Shigella flexneri effector OspI C62S mutant
4IP3 2.3 Å, Complex structure of OspI and Ubc13
3W31 2.96 Å, Structual basis for the recognition of Ubc13 by the Shigella flexneri effector OspI

Browse structure collections

About this viewer

MolViewer shows 3W30 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.