4XZX: Shigella flexneri effector OspI C62S mutant

Shigella flexneri effector OspI C62S mutant. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Feb 2016.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Shigella flexneri
Chains: 1
Atoms: 1,606
Mol. weight: 24.19 kDa
Released: 10 Feb 2016

Explore 4XZX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XZX contains 12 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	24-32	9
α-helix	38-53	16
α-helix	63-74	12
β-strand	79	1	1
α-helix	80-83	4
α-helix	84-89	6
α-helix	91-93	3
α-helix	99-103	5
β-strand	107-108	2	2
α-helix	109-110	2
β-strand	114	1	3
α-helix	115-129	15
β-strand	135-140	6	2
β-strand	145-151	7	2
β-strand	156-159	4	2
β-strand	160	1	4
β-strand	165	1	4
β-strand	180	1	3
α-helix	181-182	2
β-strand	186-190	5	2
α-helix	194-201	8
α-helix	204-208	5
β-strand	211	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ORF169b	A	protein	220	Shigella flexneri	Q8VSD5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4XZX_1 ORF169b (chains A)
GPLGSPEFMINGVSLQGTAGYEAHTEEGNVNVKKLLESLNSKSLGDMDKDSELAATLQKM
INPSGGDGNSSGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPN
ETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDP
VEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC

Primary citation

New insights into the active site structure of Shigella effecter OspI. Nishide, A., Takagi, K., Minsoo, K. et al. To be published.

Other PDB entries of the same protein (UniProt Q8VSD5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3B21 2.01 Å, Crystal structure of OspI from Shigella flexineri
4IP3 2.3 Å, Complex structure of OspI and Ubc13
3W31 2.96 Å, Structual basis for the recognition of Ubc13 by the Shigella flexneri effector OspI
3W30 2.99 Å, Structual basis for the recognition of Ubc13 by the Shigella flexneri effector OspI

Browse structure collections

About this viewer

MolViewer shows 4XZX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.