3WDF: Staphylococcus aureus UDG

Staphylococcus aureus UDG. Determined by X-ray diffraction at 1.48 Å resolution. Released 5 Feb 2014.

Method: X-ray diffraction
Resolution: 1.48 Å
Organism: Staphylococcus aureus
Chains: 2
Atoms: 4,019
Mol. weight: 52.14 kDa
Released: 5 Feb 2014

Explore 3WDF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WDF contains 30 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	17-29	13
β-strand	32-33	2	1
α-helix	36-38	3
α-helix	41-45	5
α-helix	48-50	3
β-strand	53-57	5	2
α-helix	60-61	2
α-helix	79-81	3
α-helix	82-94	13
α-helix	105-110	6
β-strand	112-116	5	2
β-strand	121-122	2	1
β-strand	125	1	1
α-helix	134-148	15
β-strand	153-157	5	2
α-helix	159-162	4
α-helix	163-167	5
β-strand	174-178	5	2
α-helix	186-188	3
α-helix	195-205	11
α-helix	208-211	4

Chain B: 15 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	17-29	13
β-strand	32-33	2	3
α-helix	36-38	3
α-helix	41-45	5
α-helix	48-50	3
β-strand	53-57	5	4
α-helix	79-81	3
α-helix	82-94	13
α-helix	105-110	6
β-strand	112-116	5	4
β-strand	121-122	2	3
α-helix	134-148	15
α-helix	152	1
β-strand	153-157	5	4
α-helix	159-162	4
α-helix	163-167	5
β-strand	174-178	5	4
α-helix	186-188	3
α-helix	195-205	11
α-helix	208-211	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uracil-DNA glycosylase	A, B	protein	226	Staphylococcus aureus	Q6GJ88 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3WDF_1 Uracil-DNA glycosylase (chains A, B)
MEWSQIFHDITTKHDFKAMHDFLEKEYSTAIVYPDRENIYQAFDLTPFENIKVVILGQDP
YHGPNQAHGLAFSVQPNAKFPPSLRNMYKELADDIGCVRQTPHLQDWAREGVLLLNTVLT
VRQGEANSHRDIGWETFTDEIIKAVSDYKEHVVFILWGKPAQQKIKLIDTSKHCIIKSVH
PSPLSAYRGFFGSKPYSKANTYLESVGKSPINWCESEALEHHHHHH

Primary citation

Staphylococcus aureus protein SAUGI acts as a uracil-DNA glycosylase inhibitor. Wang, H.C., Hsu, K.C., Yang, J.M. et al. Nucleic Acids Res (2013) 42:1354-1364. DOI 10.1093/nar/gkt964 · PubMed

Other PDB entries of the same protein (UniProt Q6GJ88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WDG 2.2 Å, Staphylococcus aureus UDG / UGI complex
8AIM 2.6 Å, Ugi-2 SAUNG complex

Browse structure collections

About this viewer

MolViewer shows 3WDF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.