Staphylococcus aureus UDG / UGI complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 5 Feb 2014.
Explore 3WDG in 3D Show helices and sheets RCSB PDB PDBe
3WDG contains 22 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-13 | 11 | |
| α-helix | 17-29 | 13 | |
| β-strand | 32-33 | 2 | 1 |
| α-helix | 36-38 | 3 | |
| α-helix | 41-45 | 5 | |
| α-helix | 48-50 | 3 | |
| β-strand | 53-57 | 5 | 2 |
| α-helix | 60-61 | 2 | |
| α-helix | 79-81 | 3 | |
| α-helix | 82-94 | 13 | |
| α-helix | 105-109 | 5 | |
| β-strand | 112-116 | 5 | 2 |
| β-strand | 121-122 | 2 | 1 |
| β-strand | 125 | 1 | 1 |
| α-helix | 134-148 | 15 | |
| β-strand | 153-157 | 5 | 2 |
| α-helix | 159-162 | 4 | |
| α-helix | 165-167 | 3 | |
| β-strand | 174-178 | 5 | 2 |
| α-helix | 186-188 | 3 | |
| α-helix | 195-205 | 11 | |
| α-helix | 209-211 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 22-23 | 2 | |
| β-strand | 24-31 | 8 | 3 |
| α-helix | 32-34 | 3 | |
| α-helix | 38-40 | 3 | |
| α-helix | 49 | 1 | |
| β-strand | 50-57 | 8 | 3 |
| α-helix | 59-63 | 5 | |
| β-strand | 67-73 | 7 | 3 |
| β-strand | 76-83 | 8 | 3 |
| β-strand | 89-95 | 7 | 3 |
| β-strand | 100-103 | 4 | 3 |
| α-helix | 105-108 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uracil-DNA glycosylase | A | protein | 226 | Staphylococcus aureus | Q6GJ88 (AlphaFold model) |
| Uncharacterized protein | B | protein | 112 | Staphylococcus aureus | Q936H5 (AlphaFold model) |
>3WDG_1 Uracil-DNA glycosylase (chains A) MEWSQIFHDITTKHDFKAMHDFLEKEYSTAIVYPDRENIYQAFDLTPFENIKVVILGQDP YHGPNQAHGLAFSVQPNAKFPPSLRNMYKELADDIGCVRQTPHLQDWAREGVLLLNTVLT VRQGEANSHRDIGWETFTDEIIKAVSDYKEHVVFILWGKPAQQKIKLIDTSKHCIIKSVH PSPLSAYRGFFGSKPYSKANTYLESVGKSPINWCESEALEHHHHHH
>3WDG_2 Uncharacterized protein (chains B) MTLELQLKHYITNLFNLPKDEKWECESIEEIADDILPDQYVRLGALSNKILQTYTYYSDT LHESNIYPFILYYQKQLIAIGYIDENHDMDFLYLHNTIMPLLDQRYLLTGGQ
Staphylococcus aureus protein SAUGI acts as a uracil-DNA glycosylase inhibitor. Wang, H.C., Hsu, K.C., Yang, J.M. et al. Nucleic Acids Res (2013) 42:1354-1364. DOI 10.1093/nar/gkt964 · PubMed
Other PDB entries of the same protein (UniProt Q6GJ88 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WDG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.