3WE6: Anti-Prostaglandin E2 Fab fragment

Crystal structure of anti-Prostaglandin E2 Fab fragment. Determined by X-ray diffraction at 2.02 Å resolution. Released 2 Jul 2014.

Method: X-ray diffraction
Resolution: 2.02 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,798
Mol. weight: 47.46 kDa
Ligands: IPA
Released: 2 Jul 2014

Explore 3WE6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WE6 contains 17 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
α-helix	7-9	3
β-strand	10-12	3	2
β-strand	18-25	8	1
β-strand	32-39	8	2
β-strand	46-52	7	2
β-strand	57-60	4	2
α-helix	62-64	3
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-100	9	2
β-strand	106-107	2	2
β-strand	111-115	5	2
β-strand	121	1	3
α-helix	122-123	2
β-strand	124-128	5	4
β-strand	139-149	11	4
β-strand	150	1	3
β-strand	155-158	4	5
α-helix	159-161	3
β-strand	163	1	5
β-strand	167-169	3	4
α-helix	170-172	3
β-strand	173-175	3	4
β-strand	178-188	11	4
α-helix	189-191	3
β-strand	198-203	6	5
α-helix	204-206	3
β-strand	208-213	6	5

Chain B: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	30	1	8
β-strand	36	1	8
β-strand	38-43	6	7
β-strand	50-54	5	7
β-strand	58-59	2	7
α-helix	60	1
β-strand	67-72	6	6
β-strand	75-80	6	6
α-helix	85-87	3
β-strand	89-95	7	7
α-helix	101	1
β-strand	102-103	2	7
β-strand	107-111	5	7
β-strand	116	1	9
β-strand	119-123	5	10
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	10
β-strand	145	1	9
β-strand	150-155	6	11
β-strand	158-160	3	11
β-strand	164-168	5	10
α-helix	169-172	4
β-strand	178-187	10	10
α-helix	188-191	4
β-strand	196-202	7	11
α-helix	209	1
β-strand	210-215	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mAb Fab H fragment	A	protein	218	Mus musculus
mAb Fab L fragment	B	protein	217	Mus musculus	A2NHM3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3WE6_1 mAb Fab H fragment (chains A)
KVQLQQSGAELVKPGASVKLSCKASGYTFTEYFIHWVKQRSGQGLEWIGWFYPGSGSLNY
NGKFKDKATFTADKSSSTVYLELSRLTSEDSAVYFCASHAYDKEPYWGQGTLVTVSAAKT
TPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYT
LSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD

Sequence of entity 2 (B), FASTA

>3WE6_2 mAb Fab L fragment (chains B)
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKINRVEAEDLGIYYCLQGSHVPLTFGAGTTLELKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	1

Primary citation

Crystal structure of anti-Prostaglandin E2 Fab fragment with Prostaglandin E2. Sugahara, M., Ago, H., Saino, H. et al. To be published.

Other PDB entries of the same protein (UniProt A2NHM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PXR 1.56 Å, Anti-TAU BIIB092 FAB with TAU peptide
4TPR 1.6 Å, Structure of Tau5 antibody Fab fragment
4TQE 1.6 Å, Structure of tau peptide in complex with Tau5 antibody Fab fragment
3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2DQU 1.7 Å, Crystal form II: high resolution crystal structure of the complex of the hydrolytic…
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
1ZEA 1.78 Å, Structure of the anti-cholera toxin antibody Fab fragment TE33 in complex with a D-peptide
1PZ5 1.8 Å, Structural basis of peptide-carbohydrate mimicry in an antibody combining site
2DQT 1.8 Å, High resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and…

Browse structure collections

About this viewer

MolViewer shows 3WE6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.