Crystal structure of S6K1 kinase domain in complex with a quinoline derivative 2-oxo-2-[(4-sulfamoylphenyl)amino]ethyl 7,8,9,10-tetrahydro-6H-cyclohepta[b]quinoline-11-carboxylate. Determined by X-ray diffraction at 1.98 Å resolution. Released 6 Aug 2014.
Explore 3WF8 in 3D Show helices and sheets RCSB PDB PDBe
3WF8 contains 16 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 88-90 | 3 | |
| β-strand | 91-99 | 9 | 1 |
| β-strand | 103-110 | 8 | 1 |
| β-strand | 119-126 | 8 | 1 |
| α-helix | 127-130 | 4 | |
| α-helix | 134-149 | 16 | |
| β-strand | 155 | 1 | 2 |
| α-helix | 156-157 | 2 | |
| β-strand | 158-163 | 6 | 1 |
| β-strand | 167-173 | 7 | 1 |
| β-strand | 179 | 1 | 2 |
| α-helix | 180-187 | 8 | |
| α-helix | 192-211 | 20 | |
| α-helix | 221-223 | 3 | |
| β-strand | 224-226 | 3 | 2 |
| β-strand | 232-234 | 3 | 2 |
| α-helix | 262-265 | 4 | |
| α-helix | 273-288 | 16 | |
| α-helix | 298-307 | 10 | |
| α-helix | 318-327 | 10 | |
| α-helix | 332-334 | 3 | |
| α-helix | 343-347 | 5 | |
| α-helix | 350-352 | 3 | |
| α-helix | 357-361 | 5 | |
| α-helix | 366-367 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribosomal protein S6 kinase beta-1 | A | protein | 329 | Homo sapiens | P23443 (AlphaFold model) |
>3WF8_1 Ribosomal protein S6 kinase beta-1 (chains A) GSFTSSGSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMI VRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIF MEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVT HTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKL NLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFK PLLQSEEDVSQFDSKFTRQTPVDSPDDST
| ID | Name | Formula | Copies |
|---|---|---|---|
| F76 | 2-oxo-2-[(4-sulfamoylphenyl)amino]ethyl 7,8,9,10-tetrahydro-6H-cyclohepta[b]qui… | C23 H23 N3 O5 S | 1 |
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (GOL) are not listed.
Crystal structures of the S6K1 kinase domain in complexes with inhibitors. Niwa, H., Mikuni, J., Sasaki, S. et al. J Struct Funct Genomics (2014) 15:153-164. DOI 10.1007/s10969-014-9188-8 · PubMed
Other PDB entries of the same protein (UniProt P23443 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WF8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.