3WFN: Nav1.6 IQ motif

Crystal Structure of Nav1.6 IQ motif in complex with apo-CaM. Determined by X-ray diffraction at 1.95 Å resolution. Released 28 Aug 2013.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Mus musculus
Chains: 4
Atoms: 5,694
Mol. weight: 81.93 kDa
Released: 28 Aug 2013

Explore 3WFN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WFN contains 38 α-helices and 17 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-4	4
α-helix	7-19	13
β-strand	27-29	3	1
α-helix	30-32	3
α-helix	33-39	7
α-helix	46-54	9
β-strand	63-65	3	1
α-helix	66-93	28
β-strand	100-102	3	2
α-helix	103-112	10
α-helix	119-128	10
β-strand	136-138	3	2
α-helix	139-146	8
α-helix	154-174	21

Chain C: 10 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	1-4	4
α-helix	7-19	13
β-strand	27-29	3	3
α-helix	30-39	10
α-helix	46-55	10
β-strand	63-65	3	3
α-helix	66-92	27
β-strand	100-102	3	4
α-helix	103-112	10
α-helix	116-118	3
α-helix	119-129	11
β-strand	131	1	4
β-strand	136-138	3	4
α-helix	139-146	8
α-helix	155-173	19

Chain D: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-4	4
α-helix	7-18	12
β-strand	27-29	3	5
β-strand	63-65	3	5
α-helix	66-93	28
β-strand	100-102	3	6
α-helix	103-112	10
α-helix	116-118	3
α-helix	119-128	10
β-strand	136-138	3	6
α-helix	139-146	8
α-helix	154-173	20

Chain E: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-4	4
α-helix	7-19	13
β-strand	27-29	3	7
α-helix	30-32	3
α-helix	33-39	7
α-helix	46-54	9
β-strand	63-65	3	7
α-helix	66-93	28
β-strand	100-102	3	8
α-helix	103-112	10
α-helix	119-128	10
β-strand	136-138	3	8
α-helix	139-146	8
α-helix	155-174	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin, Sodium channel protein type 8 subunit alpha	B, C, D, E	protein	182	Mus musculus	P0DP26 (AlphaFold model), Q9WTU3 (AlphaFold model)

Sequence of entity 1 (B, C, D, E), FASTA

>3WFN_1 Calmodulin, Sodium channel protein type 8 subunit alpha (chains B, C, D, E)
HHHHHHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLG
EKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKGGGGGEEVSAVVLQRAYRGHLARRG
FI

Primary citation

Structural Basis for the Modulation of the Neuronal Voltage-Gated Sodium Channel NaV1.6 by Calmodulin. Chichili, V.P.R., Xiao, Y., Seetharaman, J. et al. Sci Rep (2013) 3:2435-2435. DOI 10.1038/srep02435 · PubMed

Other PDB entries of the same protein (UniProt P0DP26 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CQP 1.9 Å, Complex of TRPC4 and Calmodulin_Nlobe
4HEX 2.0 Å, A novel conformation of calmodulin
2IX7 2.5 Å, Structure of apo-calmodulin bound to unconventional myosin V
4ZLK 2.5 Å, Crystal structure of mouse myosin-5a in complex with calcium-bound calmodulin
4E53 2.69 Å, Calmodulin and Nm peptide complex
4E50 2.7 Å, Calmodulin and Ng peptide complex
9CFV 2.7 Å, Cryo-EM structure of delta-NTR myosin-1c bound to F-actin
9CFX 2.7 Å, Cryo-EM structure of myosin-1c bound to F-actin in the Rigor state
9CFU 2.8 Å, Cryo-EM structure of myosin-1c bound to F-actin in the ADP-A state
9CFW 3.0 Å, Cryo-EM structure of myosin-1c bound to F-actin in the ADP-B state
8PB1 3.5 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
8W41 3.54 Å, Cryo-EM structure of Myosin VI in the autoinhibited state

Browse structure collections

About this viewer

MolViewer shows 3WFN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.