3WOY: CLASP2 TOG domain

Crystal structure of CLASP2 TOG domain (TOG2). Determined by X-ray diffraction at 2.1 Å resolution. Released 27 May 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,166
Mol. weight: 28.18 kDa
Released: 27 May 2015

Explore 3WOY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WOY contains 19 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	64-75	12
α-helix	85-100	16
α-helix	106-121	16
α-helix	124-126	3
α-helix	128-136	9
α-helix	138-144	7
α-helix	150-167	18
α-helix	168-171	4
α-helix	172-185	14
α-helix	191-207	17
α-helix	213-220	8
α-helix	226-242	17
α-helix	245-248	4
α-helix	249-251	3
α-helix	252-263	12
α-helix	268-284	17
α-helix	286-294	9
α-helix	298-303	6
α-helix	305-307	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CLIP-associating protein 2	A	protein	251	Homo sapiens	O75122 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3WOY_1 CLIP-associating protein 2 (chains A)
GGAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSL
LVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIV
PTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLL
LQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPS
YQKSLQTYLKS

Primary citation

CLASP2 Has Two Distinct TOG Domains That Contribute Differently to Microtubule Dynamics. Maki, T., Grimaldi, A.D., Fuchigami, S. et al. J Mol Biol (2015) 427:2379-2395. DOI 10.1016/j.jmb.2015.05.012 · PubMed

Other PDB entries of the same protein (UniProt O75122 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NR4 1.2 Å, Crystal structure of Clasp2 TOG1 domain
8WHJ 1.4 Å, Crystal structure of CLASP2 TOG4 fused with LL5beta
8WHI 1.85 Å, Crystal structure of native CLASP2 in complex with CLIP170
8WHK 2.4 Å, Crystal structure of CLASP2 in complex with LL5beta
8WHL 3.2 Å, Crystal structure of CLASP2 in complex with CENP-E
8WHH 3.8 Å, Crystal structure of Se-Met derivative CLASP2 in complex with CLIP170

Browse structure collections

About this viewer

MolViewer shows 3WOY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.