8WHK: CLASP2

Crystal structure of CLASP2 in complex with LL5beta. Determined by X-ray diffraction at 2.4 Å resolution. Released 28 Aug 2024.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,244
Mol. weight: 33.32 kDa
Released: 28 Aug 2024

Explore 8WHK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WHK contains 19 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	1255-1265	11
α-helix	1272-1287	16
α-helix	1294-1308	15
α-helix	1314-1330	17
α-helix	1332-1335	4
α-helix	1339-1348	10
α-helix	1349-1351	3
α-helix	1355-1371	17
α-helix	1374-1387	14
α-helix	1388-1389	2
α-helix	1392-1404	13
α-helix	1409-1413	5
α-helix	1416-1426	11
α-helix	1432-1449	18
α-helix	1450-1452	3
α-helix	1454-1457	4
α-helix	1462-1475	14

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	722-732	11
α-helix	735-769	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CLIP-associating protein 2	A	protein	235	Homo sapiens	O75122 (AlphaFold model)
Pleckstrin homology-like domain family B member 2	B	protein	57	Homo sapiens	Q86SQ0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8WHK_1 CLIP-associating protein 2 (chains A)
GPGSEFSLDHSDLVAELLKELSNHNERVEERKIALYELMKLTQEESFSVWDEHFKTILLL
LLETLGDKEPTIRALALKVLREILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEA
ASVLATSISPEQCIKVLCPIIQTADYPINLAAIKMQTKVIERVSKETLNLLLPEIMPGLI
QGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGS

Sequence of entity 2 (B), FASTA

>8WHK_2 Pleckstrin homology-like domain family B member 2 (chains B)
GPGSEFKHFEDLEFQQLEHESRLDEEKENLTQQLLREVAEYQRNIVSRKEKISALKK

Primary citation

CLASP-mediated competitive binding in protein condensates directs microtubule growth. Jia, X., Lin, L., Guo, S. et al. Nat Commun (2024) 15:6509-6509. DOI 10.1038/s41467-024-50863-3 · PubMed

Other PDB entries of the same protein (UniProt O75122 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NR4 1.2 Å, Crystal structure of Clasp2 TOG1 domain
8WHJ 1.4 Å, Crystal structure of CLASP2 TOG4 fused with LL5beta
8WHI 1.85 Å, Crystal structure of native CLASP2 in complex with CLIP170
3WOY 2.1 Å, Crystal structure of CLASP2 TOG domain (TOG2)
8WHL 3.2 Å, Crystal structure of CLASP2 in complex with CENP-E
8WHH 3.8 Å, Crystal structure of Se-Met derivative CLASP2 in complex with CLIP170

Browse structure collections

About this viewer

MolViewer shows 8WHK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.