5NR4: Clasp2 TOG1 domain

Crystal structure of Clasp2 TOG1 domain. Determined by X-ray diffraction at 1.2 Å resolution. Released 30 May 2018.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,138
Mol. weight: 51.51 kDa
Released: 30 May 2018

Explore 5NR4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NR4 contains 28 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	7-13	7
α-helix	19-21	3
α-helix	22-34	13
α-helix	46-61	16
α-helix	65-82	18
α-helix	83-89	7
α-helix	90-100	11
α-helix	106-122	17
α-helix	126-133	8
α-helix	134-138	5
α-helix	142-159	18
α-helix	166-176	11
α-helix	182-199	18
α-helix	202-207	6
α-helix	214-225	12

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	19-33	15
α-helix	50-60	11
α-helix	65-82	18
α-helix	83-89	7
α-helix	90-100	11
α-helix	106-122	17
α-helix	126-133	8
α-helix	134-138	5
α-helix	142-159	18
α-helix	166-176	11
α-helix	182-199	18
α-helix	202-208	7
α-helix	214-228	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CLIP-associating protein 2	A, B	protein	230	Homo sapiens	O75122 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5NR4_1 CLIP-associating protein 2 (chains A, B)
GPMEPRSMEYFCAQVQQKDVGGRLQVGQELLLYLGAPGAISDLEEDLGRLGKTVDALTGW
VGSSNYRVSLMGLEILSAFVDRLSTRFKSYVAMVIVALIDRMGDAKDKVRDEAQTLILKL
MDQVAPPMYIWEQLASGFKHKNFRSREGVCLCLIETLNIFGAQPLVISKLIPHLCILFGD
SNSQVRDAAILAIVEIYRHVGEKVRMDLYKRGIPPARLEMIFAKFDEVQS

Primary citation

CLASP Suppresses Microtubule Catastrophes through a Single TOG Domain. Aher, A., Kok, M., Sharma, A. et al. Dev Cell (2018) 46:40-58.e8. DOI 10.1016/j.devcel.2018.05.032 · PubMed

Other PDB entries of the same protein (UniProt O75122 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8WHJ 1.4 Å, Crystal structure of CLASP2 TOG4 fused with LL5beta
8WHI 1.85 Å, Crystal structure of native CLASP2 in complex with CLIP170
3WOY 2.1 Å, Crystal structure of CLASP2 TOG domain (TOG2)
8WHK 2.4 Å, Crystal structure of CLASP2 in complex with LL5beta
8WHL 3.2 Å, Crystal structure of CLASP2 in complex with CENP-E
8WHH 3.8 Å, Crystal structure of Se-Met derivative CLASP2 in complex with CLIP170

Browse structure collections

About this viewer

MolViewer shows 5NR4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.