Flexibility of the DNA-binding domains of trp repressor. Determined by X-ray diffraction at 1.8 Å resolution. Released 16 Apr 1988.
Explore 3WRP in 3D Show helices and sheets RCSB PDB PDBe
3WRP contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-30 | 19 | |
| α-helix | 35-42 | 8 | |
| α-helix | 45-63 | 19 | |
| α-helix | 68-75 | 8 | |
| α-helix | 79-90 | 12 | |
| α-helix | 94-104 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Trp repressor | A | protein | 108 | Escherichia coli | P0A881 (AlphaFold model) |
>3WRP_1 TRP REPRESSOR (chains A) MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEE LLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
Flexibility of the DNA-binding domains of trp repressor. Lawson, C.L., Zhang, R.G., Schevitz, R.W. et al. Proteins (1988) 3:18-31. DOI 10.1002/prot.340030103 · PubMed
Other PDB entries of the same protein (UniProt P0A881 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WRP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.