Crystal structure of the b'-a' domain of thermophilic fungal protein disulfide isomerase (reduced form). Determined by X-ray diffraction at 1.85 Å resolution. Released 26 Nov 2014.
Explore 3WT1 in 3D Show helices and sheets RCSB PDB PDBe
3WT1 contains 51 α-helices and 40 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 211-212 | 2 | 1 |
| α-helix | 218-223 | 6 | |
| β-strand | 228-233 | 6 | 1 |
| α-helix | 236-252 | 17 | |
| β-strand | 258-263 | 6 | 1 |
| α-helix | 264-267 | 4 | |
| α-helix | 268-274 | 7 | |
| α-helix | 276-277 | 2 | |
| β-strand | 283-288 | 6 | 1 |
| β-strand | 293-296 | 4 | 1 |
| α-helix | 297-298 | 2 | |
| α-helix | 305-316 | 12 | |
| α-helix | 321-323 | 3 | |
| α-helix | 327-330 | 4 | |
| β-strand | 338-340 | 3 | 2 |
| α-helix | 342-344 | 3 | |
| α-helix | 345-349 | 5 | |
| β-strand | 355-361 | 7 | 2 |
| α-helix | 366-384 | 19 | |
| β-strand | 391-397 | 7 | 2 |
| β-strand | 412-416 | 5 | 2 |
| β-strand | 425-426 | 2 | 2 |
| α-helix | 433-443 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 210-212 | 3 | 3 |
| α-helix | 218-223 | 6 | |
| β-strand | 228-233 | 6 | 3 |
| α-helix | 236-252 | 17 | |
| β-strand | 258-263 | 6 | 3 |
| α-helix | 264-267 | 4 | |
| α-helix | 268-274 | 7 | |
| α-helix | 276-277 | 2 | |
| β-strand | 283-288 | 6 | 3 |
| β-strand | 293-296 | 4 | 3 |
| α-helix | 305-316 | 12 | |
| α-helix | 321-323 | 3 | |
| α-helix | 327-330 | 4 | |
| β-strand | 338-340 | 3 | 4 |
| α-helix | 342-344 | 3 | |
| α-helix | 345-349 | 5 | |
| β-strand | 355-361 | 7 | 4 |
| α-helix | 366-384 | 19 | |
| β-strand | 391-397 | 7 | 4 |
| β-strand | 412-416 | 5 | 4 |
| β-strand | 425-426 | 2 | 4 |
| α-helix | 433-443 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 210-212 | 3 | 5 |
| α-helix | 218-223 | 6 | |
| β-strand | 228-233 | 6 | 5 |
| α-helix | 236-252 | 17 | |
| β-strand | 258-263 | 6 | 5 |
| α-helix | 264-267 | 4 | |
| α-helix | 268-274 | 7 | |
| α-helix | 276-277 | 2 | |
| β-strand | 283-288 | 6 | 5 |
| β-strand | 293-296 | 4 | 5 |
| α-helix | 297-298 | 2 | |
| α-helix | 305-316 | 12 | |
| α-helix | 321-323 | 3 | |
| α-helix | 327-330 | 4 | |
| β-strand | 338-340 | 3 | 6 |
| α-helix | 342-344 | 3 | |
| α-helix | 345-349 | 5 | |
| β-strand | 355-361 | 7 | 6 |
| α-helix | 366-384 | 19 | |
| β-strand | 391-397 | 7 | 6 |
| β-strand | 412-416 | 5 | 6 |
| β-strand | 425-426 | 2 | 6 |
| α-helix | 433-443 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein disulfide-isomerase | A, B, C, D | protein | 247 | Humicola insolens | P55059 (AlphaFold model) |
>3WT1_1 Protein disulfide-isomerase (chains A, B, C, D) GPLGSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTI DAKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEP SIKSEPIPEKQEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALY AKSEFKDRVVIAKVDATANDVPDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAE NGKYKAA
Redox-dependent conformational transition of catalytic domain of protein disulfide isomerase indicated by crystal structure-based molecular dynamics simulation. Inagaki, K., Satoh, T., Itoh, S.G. et al. Chem Phys Lett (2015) 618:203-207. DOI 10.1016/j.cplett.2014.11.017
Other PDB entries of the same protein (UniProt P55059 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WT1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.