Structure of PAXX. Determined by X-ray diffraction at 3.45 Å resolution. Released 21 Jan 2015.
Explore 3WTF in 3D Show helices and sheets RCSB PDB PDBe
3WTF contains 10 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 1 |
| α-helix | 17-18 | 2 | |
| β-strand | 20-24 | 5 | 1 |
| β-strand | 39-42 | 4 | 1 |
| β-strand | 47-49 | 3 | 1 |
| α-helix | 54-64 | 11 | |
| α-helix | 73-82 | 10 | |
| β-strand | 85-90 | 6 | 1 |
| β-strand | 93-98 | 6 | 1 |
| β-strand | 105-111 | 7 | 1 |
| α-helix | 112-113 | 2 | |
| α-helix | 114-140 | 27 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 2 |
| α-helix | 17-18 | 2 | |
| β-strand | 20-25 | 6 | 2 |
| β-strand | 38-42 | 5 | 2 |
| β-strand | 47-49 | 3 | 2 |
| α-helix | 54-63 | 10 | |
| α-helix | 73-82 | 10 | |
| β-strand | 85-89 | 5 | 2 |
| β-strand | 93-98 | 6 | 2 |
| β-strand | 105-111 | 7 | 2 |
| α-helix | 112-113 | 2 | |
| α-helix | 114-140 | 27 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uncharacterized protein C9orf142 | A, B | protein | 206 | Homo sapiens | Q9BUH6 (AlphaFold model) |
>3WTF_1 Uncharacterized protein C9orf142 (chains A, B) GSMDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLA ALKARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAA PRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRR RCPGESLINPGFKSKKPAGGVDFDET
DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Ochi, T., Blackford, A.N., Coates, J. et al. Science (2015) 347:185-188. DOI 10.1126/science.1261971 · PubMed
Other PDB entries of the same protein (UniProt Q9BUH6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WTF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.