3ZLX: MEK1

Crystal structure of MEK1 in complex with fragment 18. Determined by X-ray diffraction at 2.2 Å resolution. Released 22 May 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,548
Mol. weight: 39.2 kDa
Ligands: 5EZ
Released: 22 May 2013

Explore 3ZLX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZLX contains 20 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	44-58	15
α-helix	65-67	3
β-strand	68-76	9	1
β-strand	80-87	8	1
β-strand	93-100	8	1
α-helix	105-115	11
α-helix	116-119	4
β-strand	126	1	2
β-strand	129-135	7	1
β-strand	138-143	6	1
β-strand	150	1	2
α-helix	151-158	8
α-helix	163-184	22
α-helix	193-195	3
β-strand	196-198	3	2
β-strand	204-206	3	2
α-helix	213-218	6
α-helix	232-235	4
α-helix	243-258	16
α-helix	265-266	2
α-helix	268-275	8
α-helix	310-319	10
α-helix	321-323	3
α-helix	325-326	2
α-helix	332-342	11
α-helix	350-351	2
α-helix	352-356	5
α-helix	359-366	8
α-helix	371-379	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dual specificity mitogen-activated protein kinase kinase 1	A	protein	348	HOMO SAPIENS	Q02750 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3ZLX_1 DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1 (chains A)
GLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMA
RKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVL
KKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQL
IDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMF
GCQVEGDAAETPPRPRTPGRPLNKKGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQ
DFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQ

Ligands and cofactors

ID	Name	Formula	Copies
5EZ	7-choro-6-[(3R)-pyrrolidin-3-ylmethoxy]isoquinolin-1(2H)-one	C14 H15 Cl N2 O2	1

Primary citation

The Use of Virtual Screening and Differential Scanning Fluorimetry for the Rapid Identification of Fragments Active Against Mek1. Amaning, K., Lowinski, M., Vallee, F. et al. Bioorg Med Chem Lett (2013) 23:3620. DOI 10.1016/J.BMCL.2013.04.003 · PubMed

Other PDB entries of the same protein (UniProt Q02750 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7B7R 1.7 Å, MEK1 in complex with compound 4
7B9L 1.7 Å, MEK1 in complex with compound 23
3EQC 1.8 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
3EQI 1.9 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
3EQH 2.0 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
3VVH 2.0 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in complex…
7B94 2.0 Å, MEK1 in complex with compound 6
7F2X 2.01 Å, Crystal structure of MEK1 C121S mutant
9AXX 2.07 Å, Crystal structure of BRAF/MEK1 complex with NST-628 and an active RAF dimer
3EQD 2.1 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
4AN3 2.1 Å, Crystal structures of human MEK1 with carboxamide-based allosteric inhibitor XL518…
7XLP 2.1 Å, MEK1 bound to DS03090629

Browse structure collections

About this viewer

MolViewer shows 3ZLX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.