7F2X: MEK1 C121S mutant

Crystal structure of MEK1 C121S mutant. Determined by X-ray diffraction at 2.01 Å resolution. Released 22 Jun 2022.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,438
Mol. weight: 36.22 kDa
Ligands: ANP
Released: 22 Jun 2022

Explore 7F2X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F2X contains 16 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	44-60	17
α-helix	65-67	3
β-strand	68-77	10	1
β-strand	80-87	8	1
β-strand	92-100	9	1
α-helix	105-118	14
β-strand	126	1	2
β-strand	129-134	6	1
β-strand	138-144	7	1
β-strand	149-150	2	2
α-helix	151-158	8
α-helix	163-183	21
α-helix	193-195	3
β-strand	196-198	3	2
β-strand	204-206	3	2
α-helix	213-221	9
α-helix	232-238	7
α-helix	242-258	17
α-helix	269-281	13
α-helix	283-285	3
α-helix	287-288	2
α-helix	294-303	10
α-helix	314-318	5
α-helix	321-328	8
α-helix	333-340	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MEK1 F11	A	protein	321	Homo sapiens	Q02750 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7F2X_1 MEK1 F11 (chains A)
MTLQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHL
EIKPAIRNQIIRELQVLHESNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRI
PEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIGSGSGSMAIFELLDYIVN
EPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTI
GLNQPSTPTHAAGEGHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

Qualitative differences in disease-associated MEK mutants reveal molecular signatures and aberrant signaling-crosstalk in cancer. Kubota, Y., Fujioka, Y., Patil, A. et al. Nat Commun (2022) 13:4063-4063. DOI 10.1038/s41467-022-31690-w · PubMed

Other PDB entries of the same protein (UniProt Q02750 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7B7R 1.7 Å, MEK1 in complex with compound 4
7B9L 1.7 Å, MEK1 in complex with compound 23
3EQC 1.8 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
3EQI 1.9 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
3EQH 2.0 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
3VVH 2.0 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in complex…
7B94 2.0 Å, MEK1 in complex with compound 6
9AXX 2.07 Å, Crystal structure of BRAF/MEK1 complex with NST-628 and an active RAF dimer
3EQD 2.1 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
4AN3 2.1 Å, Crystal structures of human MEK1 with carboxamide-based allosteric inhibitor XL518…
7XLP 2.1 Å, MEK1 bound to DS03090629
7XNC 2.1 Å, MEK1 bound to DS94070624

Browse structure collections

About this viewer

MolViewer shows 7F2X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.