Crystal structure of the OTU domain of OTULIN at 1.3 Angstroms. Determined by X-ray diffraction at 1.3 Å resolution. Released 26 Jun 2013.
Explore 3ZNV in 3D Show helices and sheets RCSB PDB PDBe
3ZNV contains 19 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 82 | 1 | 1 |
| α-helix | 83-85 | 3 | |
| β-strand | 86-87 | 2 | 2 |
| α-helix | 88-95 | 8 | |
| α-helix | 101-114 | 14 | |
| β-strand | 119-121 | 3 | 2 |
| α-helix | 122 | 1 | |
| β-strand | 123 | 1 | 1 |
| α-helix | 124 | 1 | |
| α-helix | 129-140 | 12 | |
| α-helix | 147-150 | 4 | |
| α-helix | 153-164 | 12 | |
| α-helix | 166-170 | 5 | |
| α-helix | 184-204 | 21 | |
| α-helix | 208-218 | 11 | |
| α-helix | 223-248 | 26 | |
| α-helix | 255-262 | 8 | |
| α-helix | 269-275 | 7 | |
| α-helix | 277-279 | 3 | |
| β-strand | 280 | 1 | 3 |
| β-strand | 284 | 1 | 3 |
| α-helix | 288-298 | 11 | |
| β-strand | 301-306 | 6 | 4 |
| α-helix | 307-309 | 3 | |
| α-helix | 313-315 | 3 | |
| β-strand | 316-319 | 4 | 4 |
| α-helix | 328 | 1 | |
| β-strand | 329-334 | 6 | 4 |
| β-strand | 340-341 | 2 | 4 |
| β-strand | 342-344 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein FAM105B | A | protein | 275 | HOMO SAPIENS | Q96BN8 (AlphaFold model) |
>3ZNV_1 PROTEIN FAM105B (chains A) GPLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQ AMSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRK KWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFS VLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFIT VYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (GOL, CL) are not listed.
Otulin Antagonizes Lubac Signaling by Specifically Hydrolyzing met1-Linked Polyubiquitin. Keusekotten, K., Elliott, P.R., Glockner, L. et al. Cell (2013) 153:1312. DOI 10.1016/J.CELL.2013.05.014 · PubMed
Other PDB entries of the same protein (UniProt Q96BN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ZNV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.