Circular permutant of ribosomal protein S6, lacking edge strand beta- 2 of wild-type S6. Determined by X-ray diffraction at 0.96 Å resolution. Released 23 Nov 2011.
Explore 3ZZP in 3D Show helices and sheets RCSB PDB PDBe
3ZZP contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-13 | 7 | 1 |
| α-helix | 16-27 | 12 | |
| β-strand | 32-39 | 8 | 1 |
| β-strand | 45-52 | 8 | 1 |
| α-helix | 58-75 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribosomal protein S6 | A | protein | 77 | THERMUS THERMOPHILUS | Q5SLP8 (AlphaFold model) |
>3ZZP_1 RIBOSOMAL PROTEIN S6 (chains A) MDPQGYTTWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQ LQNEKEIIQRALENYGA
Trimming Down a Protein Structure to its Bare Foldons: Spatial Organization of the Cooperative Unit. Haglund, E., Danielsson, J., Kadhirvel, S. et al. J Biol Chem (2012) 287:2731. DOI 10.1074/JBC.M111.312447 · PubMed
Other PDB entries of the same protein (UniProt Q5SLP8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ZZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.