6I6S: PDB entry 6I6S

Name: PDB 6I6S: Circular permutant of ribosomal protein S6, adding 9aa to C terminal of P68-69, L75A mutant
Published: 2019-11-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

Circular permutant of ribosomal protein S6, adding 9aa to C terminal of P68-69, L75A mutant. Determined by X-ray diffraction at 1.46 Å resolution. Released 27 Nov 2019.

Method: X-ray diffraction
Resolution: 1.46 Å
Organisms: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579), Thermus thermophilus HB8
Chains: 2
Atoms: 1,706
Mol. weight: 24.64 kDa
Released: 27 Nov 2019

Explore 6I6S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I6S contains 5 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-12	9
β-strand	17-24	8	1
β-strand	30-37	8	1
α-helix	43-59	17
β-strand	63-74	12	1
β-strand	84-93	10	1

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-12	12
β-strand	17-24	8	2
β-strand	30-37	8	2
α-helix	43-59	17
α-helix	62	1
β-strand	63-74	12	2
β-strand	84-93	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein…	A, B	protein	105	Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579), Thermus thermophilus HB8	Q5SLP8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6I6S_1 30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6 (chains A, B)
MEDRVNDAARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALEN
YGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLAR

Primary citation

Exposing the distinctive modular behavior of beta-strands and alpha-helices in folded proteins. Wang, H., Logan, D.T., Danielsson, J. et al. Proc Natl Acad Sci U S A (2020) 117:28775-28783. DOI 10.1073/pnas.1920455117 · PubMed

Other PDB entries of the same protein (UniProt Q5SLP8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZZP 0.96 Å, Circular permutant of ribosomal protein S6, lacking edge strand beta- 2 of wild-type S6.
6I69 1.2 Å, Circular permutant of ribosomal protein S6, adding 5aa to C terminal of P97-3, L10A mutant
6I6E 1.2 Å, Circular permutant of ribosomal protein S6, swap strand 1 , L10A mutant
6I6W 1.49 Å, Circular permutant of ribosomal protein S6, adding 6aa to C terminal of P68-69
6I6I 1.5 Å, Circular permutant of ribosomal protein S6, adding 6aa to C terminal of P68-69, L75A…
6I6U 1.57 Å, Circular permutant of ribosomal protein S6, adding 9aa to N terminal of P81-82, L75A…
1CQM 1.65 Å, Protein aggregation and alzheimer's disease: crystallographic analysis of the…
7OS7 1.65 Å, Circular permutant of ribosomal protein S6, swap helix 2, L75A, A92K mutant
7BFF 1.66 Å, Circular permutant of ribosomal protein S6, P54-55 truncated, I25A mutant.
7B8V 1.86 Å, Circular permutant of ribosomal protein S6, P54-55
6I6O 1.9 Å, Circular permutant of ribosomal protein S6, swap helix 2, L75A mutant
7BFE 1.95 Å, Circular permutant of ribosomal protein S6, P54-55 truncated, L21A mutant.

Browse structure collections

About this viewer

MolViewer shows 6I6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.