Circular permutant of ribosomal protein S6, adding 6aa to C terminal of P68-69. Determined by X-ray diffraction at 1.49 Å resolution. Released 27 Nov 2019.
Explore 6I6W in 3D Show helices and sheets RCSB PDB PDBe
6I6W contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-12 | 11 | |
| β-strand | 17-24 | 8 | 1 |
| β-strand | 30-37 | 8 | 1 |
| α-helix | 43-59 | 17 | |
| β-strand | 63-74 | 12 | 1 |
| β-strand | 84-93 | 10 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 30S ribosomal protein S6,30S ribosomal protein S6 | A | protein | 102 | Thermus thermophilus HB8 | Q5SLP8 (AlphaFold model) |
>6I6W_1 30S ribosomal protein S6,30S ribosomal protein S6 (chains A) MEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALEN YGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVND
Exposing the distinctive modular behavior of beta-strands and alpha-helices in folded proteins. Wang, H., Logan, D.T., Danielsson, J. et al. Proc Natl Acad Sci U S A (2020) 117:28775-28783. DOI 10.1073/pnas.1920455117 · PubMed
Other PDB entries of the same protein (UniProt Q5SLP8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6I6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.