4A3T: DNA mismatch repair protein HSM3

Name: PDB 4A3T: yeast regulatory particle proteasome assembly chaperone Hsm3
Published: 2012-04-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

yeast regulatory particle proteasome assembly chaperone Hsm3. Determined by X-ray diffraction at 2.1 Å resolution. Released 11 Apr 2012.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 2
Atoms: 7,918
Mol. weight: 112.03 kDa
Released: 11 Apr 2012

Explore 4A3T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4A3T contains 80 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 39 helices, 0 β-strands

Element	Residues	Length
α-helix	9-19	11
α-helix	29-41	13
α-helix	52-63	12
α-helix	73-86	14
α-helix	89-95	7
α-helix	98-105	8
α-helix	110-121	12
α-helix	134-142	9
α-helix	150-163	14
α-helix	167-171	5
α-helix	172-176	5
α-helix	178-187	10
α-helix	190-204	15
α-helix	209-211	3
α-helix	214-217	4
α-helix	221-228	8
α-helix	231-250	20
α-helix	254-256	3
α-helix	257-260	4
α-helix	261-263	3
α-helix	264-272	9
α-helix	278-295	18
α-helix	300-309	10
α-helix	310-314	5
α-helix	320-322	3
α-helix	323-329	7
α-helix	332-338	7
α-helix	340-346	7
α-helix	354-360	7
α-helix	364-368	5
α-helix	371-373	3
α-helix	376-381	6
α-helix	384-395	12
α-helix	398-407	10
α-helix	409-416	8
α-helix	427-441	15
α-helix	445-448	4
α-helix	449-451	3
α-helix	452-464	13

Chain B: 41 helices, 0 β-strands

Element	Residues	Length
α-helix	8-20	13
α-helix	29-40	12
α-helix	52-63	12
α-helix	66-68	3
α-helix	73-86	14
α-helix	89-95	7
α-helix	98-106	9
α-helix	110-121	12
α-helix	134-142	9
α-helix	150-163	14
α-helix	167-171	5
α-helix	172-176	5
α-helix	178-187	10
α-helix	190-204	15
α-helix	209-211	3
α-helix	214-217	4
α-helix	221-228	8
α-helix	231-250	20
α-helix	254-256	3
α-helix	257-260	4
α-helix	261-263	3
α-helix	264-272	9
α-helix	278-295	18
α-helix	304-309	6
α-helix	310-314	5
α-helix	320-322	3
α-helix	323-329	7
α-helix	332-338	7
α-helix	340-346	7
α-helix	354-360	7
α-helix	364-368	5
α-helix	371-373	3
α-helix	376-381	6
α-helix	384-395	12
α-helix	398-407	10
α-helix	409-416	8
α-helix	421-423	3
α-helix	427-441	15
α-helix	445-448	4
α-helix	449-451	3
α-helix	452-464	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA mismatch repair protein HSM3	A, B	protein	485	SACCHAROMYCES CEREVISIAE	P38348 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4A3T_1 DNA MISMATCH REPAIR PROTEIN HSM3 (chains A, B)
GAMADPSEKETNYVENLLTQLENELNEDNLPEDINTLLRKCSLNLVTVVSLPDMDVKPLL
ATIKRFLTSNVSYDSLNYDYLLDVVDKLVPMADFDDVLEVYSAEDLVKALRSEIDPLKVA
ACRVIENSQPKGLFATSNIIDILLDILFDEKVENDKLITAIEKALERLSTDELIRRRLFD
NNLPYLVSVKGRMETVSFVRLIDFLTIEFQFISGPEFKDIIFCFTKEEILKSVEDILVFI
ELVNYYTKFLLEIRNQDKYWALRHVKKILPVFAQLFEDTENYPDVRAFSTNCLLQLFAEV
SRIEEDEYSLFKTMDKDSLKIGSEAKLITEWLELINPQYLVKYHKDVVENYFHVSGYSIG
MLRNLSADEECFNAIRNKFSAEIVLRLPYLEQMQVVETLTRYEYTSKFLLNEMPKVMGSL
IGDGSAGAIIDLETVHYRNSALRNLLDKGEEKLSVWYEPLLREYSKAVNGKNYSTGSETK
IADCR

Primary citation

Dual Functions of the Hsm3 Protein in Chaperoning and Scaffolding Regulatory Particle Subunits During the Proteasome Assembly. Barrault, M.B., Richet, N., Godard, C. et al. Proc Natl Acad Sci U S A (2012) 109:E1001. DOI 10.1073/PNAS.1116538109 · PubMed

Other PDB entries of the same protein (UniProt P38348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VLD 2.05 Å, Crystal structure of yeast proteasome interacting protein
4FP7 2.2 Å, 2.2A resolution structure of Proteasome Assembly Chaperone Hsm3
3VLE 2.41 Å, Crystal structure of yeast proteasome interacting protein
35ZR 2.99 Å, yeast 26S proteasome base assembly intermediate, Hsm3-Rpt1-Rpt2 (base-Hsm3-Nas6 with…
35ZW 3.31 Å, yeast 26S proteasome base assembly intermediate, Hsm3-Rpt1-Rpt2-Rpt3-Rpt4-Rpt5…
3VLF 3.8 Å, Crystal structure of yeast proteasome interacting protein
4A3V 3.8 Å, yeast regulatory particle proteasome assembly chaperone Hsm3 in complex with Rpt1…
36BM 3.82 Å, yeast 26S proteasome base assembly intermediate, base-Hsm3-Nas6 with Rpt4-EQ
36BL 3.91 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6(2) with Rpt4-EQ
36BD 3.93 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6 with Rpt4-EQ
36AX 4.87 Å, yeast 26S proteasome base assembly intermediate, base-Nas2-Rpn14-Hsm3-Nas6 with Rpt4-EQ
4JPO 5.0 Å, 5A resolution structure of Proteasome Assembly Chaperone Hsm3 in complex with a…

Browse structure collections

About this viewer

MolViewer shows 4A3T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.