4JPO: DNA mismatch repair protein HSM3

5A resolution structure of Proteasome Assembly Chaperone Hsm3 in complex with a C-terminal fragment of Rpt1. Determined by X-ray diffraction at 5.0 Å resolution. Released 10 Apr 2013.

Method: X-ray diffraction
Resolution: 5.0 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 8,391
Mol. weight: 136.65 kDa
Released: 10 Apr 2013

Explore 4JPO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JPO contains 82 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 0 β-strands

Element	Residues	Length
α-helix	24-31	8
α-helix	40-50	11
α-helix	51-53	3
α-helix	64-73	10
α-helix	84-97	14
α-helix	100-106	7
α-helix	109-117	9
α-helix	121-132	12
α-helix	145-153	9
α-helix	161-174	14
α-helix	178-184	7
α-helix	189-198	10
α-helix	201-215	15
α-helix	225-228	4
α-helix	232-238	7
α-helix	242-261	20
α-helix	265-267	3
α-helix	268-271	4
α-helix	272-274	3
α-helix	276-283	8
α-helix	291-294	4
α-helix	296-308	13
α-helix	316-320	5
α-helix	321-325	5
α-helix	331-333	3
α-helix	334-340	7
α-helix	343-355	13
α-helix	365-371	7
α-helix	375-379	5
α-helix	387-391	5
α-helix	395-405	11
α-helix	409-413	5
α-helix	414-418	5
α-helix	420-427	8
α-helix	440-452	13
α-helix	456-459	4
α-helix	463-474	12

Chain B: 37 helices, 0 β-strands

Element	Residues	Length
α-helix	24-31	8
α-helix	47-50	4
α-helix	51-53	3
α-helix	64-73	10
α-helix	85-94	10
α-helix	103-106	4
α-helix	109-117	9
α-helix	121-132	12
α-helix	145-153	9
α-helix	161-174	14
α-helix	178-184	7
α-helix	189-198	10
α-helix	203-215	13
α-helix	225-228	4
α-helix	232-238	7
α-helix	242-261	20
α-helix	265-267	3
α-helix	268-271	4
α-helix	272-274	3
α-helix	276-283	8
α-helix	291-294	4
α-helix	296-308	13
α-helix	316-320	5
α-helix	321-325	5
α-helix	331-333	3
α-helix	334-340	7
α-helix	343-355	13
α-helix	366-371	6
α-helix	375-379	5
α-helix	387-391	5
α-helix	395-405	11
α-helix	409-413	5
α-helix	414-418	5
α-helix	420-427	8
α-helix	439-452	14
α-helix	456-459	4
α-helix	463-471	9

Chain C: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	384-395	12
β-strand	398	1	1
α-helix	404-410	7
α-helix	416-432	17
β-strand	438	1	1
α-helix	440-449	10

Chain D: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	384-395	12
β-strand	398	1	2
α-helix	404-410	7
α-helix	416-432	17
β-strand	438	1	2
α-helix	440-450	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA mismatch repair protein HSM3	A, B	protein	491	Saccharomyces cerevisiae	P38348 (AlphaFold model)
26S protease regulatory subunit 7 homolog	C, D	protein	100	Saccharomyces cerevisiae	P33299 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4JPO_1 DNA mismatch repair protein HSM3 (chains A, B)
GPLTRRASVGSMSEKETNYVENLLTQLENELNEDNLPEDINTLLRKCSLNLVTVVSLPDM
DVKPLLATIKRFLTSNVSYDSLNYDYLLDVVDKLVPMADFDDVLEVYSAEDLVKALRSEI
DPLKVAACRVIENSQPKGLFATSNIIDILLDILFDEKVENDKLITAIEKALERLSTDELI
RRRLFDNNLPYLVSVKGRMETVSFVRLIDFLTIEFQFISGPEFKDIIFCFTKEEILKSVE
DILVFIELVNYYTKFLLEIRNQDKYWALRHVKKILPVFAQLFEDTENYPDVRAFSTNCLL
QLFAEVSRIEEDEYSLFKTMDKDSLKIGSEAKLITEWLELINPQYLVKYHKDVVENYFHV
SGYSIGMLRNLSADEECFNAIRNKFSAEIVLRLPYLEQMQVVETLTRYEYTSKFLLNEMP
KVMGSLIGDGSAGAIIDLETVHYRNSALRNLLDKGEEKLSVWYEPLLREYSKAVNGKNYS
TGSETKIADCR

Sequence of entity 2 (C, D), FASTA

>4JPO_2 26S protease regulatory subunit 7 homolog (chains C, D)
MHHHHHHSQHMLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAG
MFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN

Primary citation

Reconfiguration of the proteasome during chaperone-mediated assembly. Park, S., Li, X., Kim, H.M. et al. Nature (2013) 497:512-516. DOI 10.1038/nature12123 · PubMed

Other PDB entries of the same protein (UniProt P38348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VLD 2.05 Å, Crystal structure of yeast proteasome interacting protein
4A3T 2.1 Å, yeast regulatory particle proteasome assembly chaperone Hsm3
4FP7 2.2 Å, 2.2A resolution structure of Proteasome Assembly Chaperone Hsm3
3VLE 2.41 Å, Crystal structure of yeast proteasome interacting protein
35ZR 2.99 Å, yeast 26S proteasome base assembly intermediate, Hsm3-Rpt1-Rpt2 (base-Hsm3-Nas6 with…
35ZW 3.31 Å, yeast 26S proteasome base assembly intermediate, Hsm3-Rpt1-Rpt2-Rpt3-Rpt4-Rpt5…
3VLF 3.8 Å, Crystal structure of yeast proteasome interacting protein
4A3V 3.8 Å, yeast regulatory particle proteasome assembly chaperone Hsm3 in complex with Rpt1…
36BM 3.82 Å, yeast 26S proteasome base assembly intermediate, base-Hsm3-Nas6 with Rpt4-EQ
36BL 3.91 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6(2) with Rpt4-EQ
36BD 3.93 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6 with Rpt4-EQ
36AX 4.87 Å, yeast 26S proteasome base assembly intermediate, base-Nas2-Rpn14-Hsm3-Nas6 with Rpt4-EQ

Browse structure collections

About this viewer

MolViewer shows 4JPO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.