Fitted model of staphylococcus aureus sav1866 model ABC transporter in the human cystic fibrosis transmembrane conductance regulator volume map EMD-1966. Determined by electron crystallography at 9.0 Å resolution. Released 11 Jan 2012.
Explore 4A82 in 3D Show helices and sheets RCSB PDB PDBe
4A82 contains 152 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-9 | 8 | |
| α-helix | 10-12 | 3 | |
| α-helix | 13-24 | 12 | |
| α-helix | 28-38 | 11 | |
| α-helix | 39-45 | 7 | |
| α-helix | 52-68 | 17 | |
| α-helix | 69-73 | 5 | |
| α-helix | 74-106 | 33 | |
| α-helix | 109-113 | 5 | |
| α-helix | 117-122 | 6 | |
| α-helix | 123-127 | 5 | |
| α-helix | 128-130 | 3 | |
| α-helix | 132-133 | 2 | |
| α-helix | 134-141 | 8 | |
| α-helix | 142-159 | 18 | |
| α-helix | 164-167 | 4 | |
| α-helix | 170-215 | 46 | |
| α-helix | 219-272 | 54 | |
| α-helix | 277-285 | 9 | |
| α-helix | 287-290 | 4 | |
| α-helix | 293-318 | 26 | |
| α-helix | 320-322 | 3 | |
| β-strand | 340-347 | 8 | 1 |
| α-helix | 354-355 | 2 | |
| β-strand | 357-364 | 8 | 1 |
| β-strand | 369-373 | 5 | 2 |
| α-helix | 380-384 | 5 | |
| β-strand | 395-400 | 6 | 1 |
| β-strand | 403-404 | 2 | 1 |
| α-helix | 405-407 | 3 | |
| α-helix | 410-415 | 6 | |
| β-strand | 417-420 | 4 | 2 |
| β-strand | 430 | 1 | 3 |
| α-helix | 431-435 | 5 | |
| α-helix | 436-438 | 3 | |
| α-helix | 444-453 | 10 | |
| α-helix | 457-461 | 5 | |
| α-helix | 466-468 | 3 | |
| β-strand | 470 | 1 | 3 |
| α-helix | 471-472 | 2 | |
| α-helix | 473-475 | 3 | |
| α-helix | 480-494 | 15 | |
| β-strand | 498-502 | 5 | 2 |
| α-helix | 510-523 | 14 | |
| β-strand | 528-532 | 5 | 2 |
| α-helix | 536-538 | 3 | |
| β-strand | 544-549 | 6 | 2 |
| β-strand | 552-557 | 6 | 2 |
| α-helix | 559-564 | 6 | |
| α-helix | 568-573 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-9 | 8 | |
| α-helix | 10-12 | 3 | |
| α-helix | 13-24 | 12 | |
| α-helix | 28-40 | 13 | |
| α-helix | 41-45 | 5 | |
| α-helix | 55-58 | 4 | |
| α-helix | 62-68 | 7 | |
| α-helix | 69-73 | 5 | |
| α-helix | 74-106 | 33 | |
| α-helix | 109-113 | 5 | |
| α-helix | 117-122 | 6 | |
| α-helix | 123-127 | 5 | |
| α-helix | 128-130 | 3 | |
| α-helix | 132-133 | 2 | |
| α-helix | 134-141 | 8 | |
| α-helix | 142-159 | 18 | |
| α-helix | 161-168 | 8 | |
| α-helix | 170-215 | 46 | |
| α-helix | 219-270 | 52 | |
| α-helix | 279-290 | 12 | |
| α-helix | 293-318 | 26 | |
| α-helix | 320-322 | 3 | |
| β-strand | 340-347 | 8 | 4 |
| α-helix | 354-355 | 2 | |
| β-strand | 357-364 | 8 | 4 |
| β-strand | 369-373 | 5 | 5 |
| α-helix | 380-384 | 5 | |
| β-strand | 395-400 | 6 | 4 |
| β-strand | 403-404 | 2 | 4 |
| α-helix | 405-407 | 3 | |
| α-helix | 410-415 | 6 | |
| β-strand | 417-420 | 4 | 5 |
| β-strand | 430 | 1 | 6 |
| α-helix | 431-435 | 5 | |
| α-helix | 436-438 | 3 | |
| α-helix | 444-453 | 10 | |
| α-helix | 457-461 | 5 | |
| α-helix | 466-468 | 3 | |
| β-strand | 470 | 1 | 6 |
| α-helix | 471-472 | 2 | |
| α-helix | 473-475 | 3 | |
| α-helix | 480-494 | 15 | |
| β-strand | 498-502 | 5 | 5 |
| α-helix | 510-523 | 14 | |
| β-strand | 528-532 | 5 | 5 |
| α-helix | 536-538 | 3 | |
| β-strand | 544-549 | 6 | 5 |
| β-strand | 552-557 | 6 | 5 |
| α-helix | 559-564 | 6 | |
| α-helix | 568-573 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cystic fibrosis transmembrane conductance regulator | A, B, C, D | protein | 578 | HOMO SAPIENS | Q99T13 (AlphaFold model) |
>4A82_1 CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR (chains A, B, C, D) MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL
The Cystic Fibrosis Transmembrane Conductance Regulator (Cftr):3D Structure and Localisation of a Channel Gate. Rosenberg, M.F., O'Ryan, L., Hughes, G. et al. J Biol Chem (2011) 286:42647. DOI 10.1074/JBC.M111.292268 · PubMed
Other PDB entries of the same protein (UniProt Q99T13 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4A82 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.