4ABM: CHMP4B hairpin

Crystal Structure of CHMP4B hairpin. Determined by X-ray diffraction at 1.8 Å resolution. Released 9 May 2012.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 2,830
Mol. weight: 37 kDa
Released: 9 May 2012

Explore 4ABM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ABM contains 8 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	20-57	38
α-helix	62-96	35

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	20-56	37
α-helix	64-95	32

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	22-55	34
α-helix	62-94	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Charged multivesicular body protein 4B	A, B, C, D	protein	79	HOMO SAPIENS	Q9H444 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4ABM_1 CHARGED MULTIVESICULAR BODY PROTEIN 4B (chains A, B, C, D)
GAMEQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQ
LAQIDGTLSTIEFQREALE

Primary citation

Cc2D1A is a Regulator of Escrt-III Chmp4B. Martinelli, N., Hartlieb, B., Usami, Y. et al. J Mol Biol (2012) 419:75. DOI 10.1016/J.JMB.2012.02.044 · PubMed

Other PDB entries of the same protein (UniProt Q9H444 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MK2 1.7 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
3C3Q 2.1 Å, ALIX Bro1-domain:CHMIP4B co-crystal structure
3UM3 3.8 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP4B

Browse structure collections

About this viewer

MolViewer shows 4ABM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.