4AMJ: Beta-1 adrenergic receptor

Turkey beta1 adrenergic receptor with stabilising mutations and bound biased agonist carvedilol. Determined by X-ray diffraction at 2.3 Å resolution. Released 23 May 2012.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: MELEAGRIS GALLOPAVO
Chains: 2
Atoms: 4,962
Mol. weight: 77.29 kDa
Ligands: CVD, 2CV
Released: 23 May 2012

Explore 4AMJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AMJ contains 37 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 0 β-strands

Element	Residues	Length
α-helix	33-68	36
α-helix	70-72	3
α-helix	75-89	15
α-helix	90-94	5
α-helix	95-104	10
α-helix	111-144	34
α-helix	146-152	7
α-helix	155-178	24
α-helix	187-194	8
α-helix	205-212	8
α-helix	213-217	5
α-helix	218-235	18
α-helix	279-315	37
α-helix	322-334	13
α-helix	335-337	3
α-helix	339-342	4
α-helix	343-345	3
α-helix	347-357	11

Chain B: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	33-68	36
α-helix	70-72	3
α-helix	75-89	15
α-helix	90-94	5
α-helix	95-104	10
α-helix	111-144	34
α-helix	146-152	7
α-helix	155-178	24
α-helix	187-194	8
α-helix	205-212	8
α-helix	213-217	5
α-helix	218-236	19
α-helix	272-274	3
α-helix	278-315	38
α-helix	322-334	13
α-helix	335-337	3
α-helix	338-342	5
α-helix	343-345	3
α-helix	347-357	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-1 adrenergic receptor	A, B	protein	315	MELEAGRIS GALLOPAVO	P07700 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4AMJ_1 BETA-1 ADRENERGIC RECEPTOR (chains A, B)
MGAELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVV
GLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQ
SLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIA
SSIISFYIPLLIMIFVALRVYREAKEQIRKIDRASKRKTSRVMLMREHKALKTLGIIMGV
FTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
FPRKADRRLHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CVD	(2S)-1-(8H-carbazol-4-yloxy)-3-[2-(2-methoxyphenoxy)ethylamino]propan-2-ol	C24 H26 N2 O4	2
2CV	Hega-10	C18 H37 N O7	12

Water and common crystallization additives (NA) are not listed.

Primary citation

Crystal Structures of a Stabilized Beta1-Adrenoceptor Bound to the Biased Agonists Bucindolol and Carvedilol. Warne, T., Edwards, P.C., Leslie, A.G. et al. Structure (2012) 20:841. DOI 10.1016/J.STR.2012.03.014 · PubMed

Other PDB entries of the same protein (UniProt P07700 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BVN 2.1 Å, Ultra-thermostable beta1-adrenoceptor with cyanopindolol bound
5A8E 2.4 Å, thermostabilised beta1-adrenoceptor with rationally designed inverse agonist…
2Y00 2.5 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound partial agonist…
6H7N 2.5 Å, Activated turkey BETA1 adrenoceptor with bound partial agonist xamoterol and nanobody…
8DCS 2.5 Å, Cryo-EM structure of cyanopindolol-bound beta1-adrenergic receptor in complex with…
2Y01 2.6 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound partial agonist…
2Y02 2.6 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound agonist carmoterol
7JJO 2.6 Å, Structural Basis of the Activation of Heterotrimeric Gs-protein by Isoproterenol-bound…
8DCR 2.6 Å, Cryo-EM structure of dobutamine-bound beta1-adrenergic receptor in complex with…
2VT4 2.7 Å, Turkey BETA1 adrenergic receptor with stabilising mutations and bound cyanopindolol
3ZPR 2.7 Å, Thermostabilised turkey beta1 adrenergic receptor with 4-methyl-2-(piperazin-1-yl)…
6H7L 2.7 Å, Activated turkey BETA1 adrenoceptor with bound partial agonist dobutamine and nanobody…

Browse structure collections

About this viewer

MolViewer shows 4AMJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.