4AQP: AXH domain of ataxin-1

The structure of the AXH domain of ataxin-1. Determined by X-ray diffraction at 2.45 Å resolution. Released 27 Mar 2013.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 3,918
Mol. weight: 55.28 kDa
Released: 27 Mar 2013

Explore 4AQP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AQP contains 23 α-helices and 39 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	566	1	1
α-helix	567-568	2
α-helix	573-575	3
β-strand	580-582	3	2
β-strand	588-590	3	2
α-helix	591-593	3
α-helix	596-604	9
β-strand	609-621	13	1
β-strand	627-634	8	1
β-strand	639-646	8	1
β-strand	651-653	3	1
β-strand	657-660	4	1
α-helix	663-670	8
β-strand	675-676	2	1
β-strand	682-688	7	1

Chain B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	568-570	3
α-helix	574-576	3
β-strand	580-582	3	2
β-strand	588-590	3	2
α-helix	591-593	3
α-helix	596-603	8
β-strand	609-621	13	3
β-strand	627-634	8	3
β-strand	639-646	8	3
β-strand	651-653	3	3
β-strand	657-660	4	3
α-helix	663-670	8
β-strand	675-676	2	3
β-strand	682-688	7	3

Chain C: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	573-575	3
β-strand	577	1	4
β-strand	579	1	4
β-strand	580-582	3	5
β-strand	588-590	3	5
α-helix	591-593	3
α-helix	596-605	10
β-strand	609-621	13	6
β-strand	627-634	8	6
α-helix	636-638	3
β-strand	639-646	8	6
β-strand	651-653	3	6
β-strand	657-660	4	6
α-helix	663-670	8
β-strand	675-676	2	6
α-helix	677	1
β-strand	682-688	7	6

Chain D: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	568-570	3
α-helix	574-576	3
β-strand	580-582	3	5
β-strand	588-590	3	5
α-helix	591-593	3
α-helix	596-605	10
β-strand	609-621	13	7
β-strand	627-634	8	7
α-helix	635-637	3
β-strand	639-646	8	7
β-strand	651-653	3	7
β-strand	657-660	4	7
α-helix	663-670	8
β-strand	675-676	2	7
α-helix	677	1
β-strand	682-688	7	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ataxin-1	A, B, C, D	protein	126	HOMO SAPIENS	P54253 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4AQP_1 ATAXIN-1 (chains A, B, C, D)
GAMAPPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSH
SPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVC
ISLTLK

Primary citation

Self-Assembly and Conformational Heterogeneity of the Axh Domain of Ataxin-1: An Unusual Example of a Chameleon Fold. De Chiara, C., Rees, M., Menon, R.P. et al. Biophys J (2013) 104:1304. DOI 10.1016/J.BPJ.2013.01.048 · PubMed

Other PDB entries of the same protein (UniProt P54253 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OA8 1.7 Å, AXH domain of human spinocerebellar ataxin-1
6QIU 1.8 Å, Crystal structure of 14-3-3 sigma in complex with Ataxin-1 Ser776 phosphopeptide
4APT 2.5 Å, The structure of the AXH domain of ataxin-1.
4J2J 2.5 Å, Crystal structure of AXH domain complex with Capicua
4J2L 3.15 Å, Crystal Structure of AXH domain complexed with Capicua
2M41 Solution Structure of the AXH domain of Ataxin-1 in complex with ligand peptide from…

Browse structure collections

About this viewer

MolViewer shows 4AQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.