4J2J: AXH domain complex with Capicua

Crystal structure of AXH domain complex with Capicua. Determined by X-ray diffraction at 2.5 Å resolution. Released 3 Apr 2013.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,161
Mol. weight: 49.99 kDa
Released: 3 Apr 2013

Explore 4J2J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4J2J contains 19 α-helices and 36 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	573-575	3
β-strand	580-582	3	1
β-strand	588-590	3	1
α-helix	591-593	3
α-helix	596-605	10
β-strand	609-624	16	2
β-strand	627-634	8	2
β-strand	639-646	8	2
α-helix	649-650	2
β-strand	651-653	3	2
β-strand	657-660	4	2
α-helix	663-670	8
β-strand	675-676	2	2
β-strand	682-688	7	2

Chain B: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	570-571	2	3
α-helix	573-575	3
β-strand	580-582	3	4
β-strand	588-590	3	4
α-helix	591-593	3
α-helix	596-605	10
β-strand	609-611	3	5
β-strand	614-621	8	6
β-strand	628-634	7	6
β-strand	640-645	6	6
α-helix	649-650	2
β-strand	651-653	3	6
β-strand	657-660	4	6
α-helix	663-669	7
β-strand	675-676	2	6
α-helix	677	1
β-strand	682-683	2	6
β-strand	686-688	3	5

Chain C: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	573-575	3
β-strand	580-582	3	7
β-strand	588-590	3	7
α-helix	591-593	3
α-helix	596-605	10
β-strand	612-620	9	3
β-strand	627-634	8	3
β-strand	639-646	8	3
β-strand	651-653	3	3
β-strand	657-660	4	3
α-helix	663-670	8
β-strand	675-676	2	3
α-helix	677	1
β-strand	682-685	4	3

Chain D: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	31-33	3	8
β-strand	35-36	2	1
α-helix	37-39	3

Chain E: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	31-33	3	8
β-strand	35-36	2	4
α-helix	37-39	3
β-strand	43	1	5

Chain F: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	34-36	3	7
α-helix	37-39	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ataxin-1	A, B, C	protein	129	Homo sapiens	P54253 (AlphaFold model)
Protein capicua homolog	D, E, F	protein	21	Homo sapiens	Q96RK0 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4J2J_1 Ataxin-1 (chains A, B, C)
EFSPAAAPPTLPPYFMKGSMIQLANGELKKVEDLKTEDFIQSAEMSNDLKIDSSTVERIE
DSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVG
DVCISLTLK

Sequence of entity 2 (D, E, F), FASTA

>4J2J_2 Protein capicua homolog (chains D, E, F)
EPRSVAVFPWHSLVPFLAPSQ

Primary citation

Structural basis of protein complex formation and reconfiguration by polyglutamine disease protein Ataxin-1 and Capicua. Kim, E., Lu, H.-C., Zoghbi, H.Y. et al. Genes Dev (2013) 27:590-595. DOI 10.1101/gad.212068.112 · PubMed

Other PDB entries of the same protein (UniProt P54253 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OA8 1.7 Å, AXH domain of human spinocerebellar ataxin-1
6QIU 1.8 Å, Crystal structure of 14-3-3 sigma in complex with Ataxin-1 Ser776 phosphopeptide
4AQP 2.45 Å, The structure of the AXH domain of ataxin-1.
4APT 2.5 Å, The structure of the AXH domain of ataxin-1.
4J2L 3.15 Å, Crystal Structure of AXH domain complexed with Capicua
2M41 Solution Structure of the AXH domain of Ataxin-1 in complex with ligand peptide from…

Browse structure collections

About this viewer

MolViewer shows 4J2J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.