2M41: AXH domain of Ataxin-1

Solution Structure of the AXH domain of Ataxin-1 in complex with ligand peptide from Capicua. Determined by solution NMR. Released 11 Dec 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,073
Mol. weight: 15.5 kDa
Released: 11 Dec 2013

Explore 2M41 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M41 contains 4 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	35-36	2	1

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	580-582	3	1
α-helix	583	1
β-strand	588-590	3	1
α-helix	591-593	3
α-helix	596-605	10
β-strand	609-610	2	2
β-strand	613-621	9	3
β-strand	627-634	8	3
β-strand	639-646	8	3
β-strand	652-653	2	3
β-strand	657-658	2	3
β-strand	659-660	2	4
α-helix	663-670	8
β-strand	675-676	2	4
β-strand	682-684	3	3
β-strand	687-688	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein capicua homolog	A	protein	15	Homo sapiens	Q96RK0 (AlphaFold model)
Ataxin-1	B	protein	126	Homo sapiens	P54253 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M41_1 Protein capicua homolog (chains A)
VFPWHSLVPFLAPSQ

Sequence of entity 2 (B), FASTA

>2M41_2 Ataxin-1 (chains B)
GAMAPPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSH
SPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVC
ISLTLK

Primary citation

Protein-Protein Interactions as a Strategy towards Protein-Specific Drug Design: The Example of Ataxin-1. de Chiara, C., Menon, R.P., Kelly, G. et al. PLoS One (2013) 8:e76456-e76456. DOI 10.1371/journal.pone.0076456 · PubMed

Other PDB entries of the same protein (UniProt Q96RK0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KZG 2.0 Å, 14-3-3 protein in Complex with CIC S301 phosphorylated peptide
4J2J 2.5 Å, Crystal structure of AXH domain complex with Capicua
6KZH 2.65 Å, 14-3-3 protein in Complex with CIC S173 phosphorylated peptide
7M5W 2.95 Å, Crystal structure of the HMG-C1 domain of human capicua bound to DNA
6JRP 3.0 Å, Crystal structure of CIC-HMG-ETV5-DNA complex
4J2L 3.15 Å, Crystal Structure of AXH domain complexed with Capicua

Browse structure collections

About this viewer

MolViewer shows 2M41 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.