4ARR: PDB entry 4ARR

Crystal structure of the N-terminal domain of Drosophila Toll receptor with the magic triangle I3C. Determined by X-ray diffraction at 3.0 Å resolution. Released 27 Feb 2013.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: DROSOPHILA MELANOGASTER, EPTATRETUS BURGERI
Chains: 2
Atoms: 4,414
Mol. weight: 65.7 kDa
Ligands: NAG, I3C
Released: 27 Feb 2013

Explore 4ARR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ARR contains 16 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	31-40	10
β-strand	44-48	5	1
β-strand	51-56	6	1
β-strand	65-70	6	1
β-strand	74-79	6	1
α-helix	84-89	6
α-helix	91	1
β-strand	97-98	2	2
β-strand	101-105	5	1
α-helix	107-109	3
α-helix	116-121	6
β-strand	124-125	2	2
β-strand	129-133	5	1
α-helix	143-146	4
β-strand	154-158	5	1
β-strand	178-182	5	1
β-strand	201-203	3	1
β-strand	225-227	3	1
β-strand	249-251	3	1
β-strand	257	1	3
α-helix	265-273	9
β-strand	278	1	1
β-strand	283	1	4
β-strand	284	1	3
β-strand	290	1	4
α-helix	291-293	3

Chain B: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	31-40	10
β-strand	44-48	5	5
β-strand	51-56	6	5
β-strand	65-70	6	5
β-strand	74-79	6	5
α-helix	84-89	6
α-helix	91	1
β-strand	97-98	2	6
β-strand	101-105	5	5
α-helix	116-121	6
β-strand	124-125	2	6
β-strand	129-133	5	5
α-helix	144-146	3
β-strand	154-158	5	5
β-strand	163	1	7
α-helix	167-170	4
β-strand	178-182	5	5
β-strand	185	1	7
β-strand	187	1	8
β-strand	201-203	3	5
β-strand	211	1	8
β-strand	225-227	3	5
β-strand	249-251	3	5
β-strand	257	1	9
α-helix	265-273	9
β-strand	278-279	2	5
β-strand	283	1	10
β-strand	284	1	9
β-strand	290	1	10
α-helix	291-293	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Toll receptor, variable lymphocyte receptor B.61 chimera	A, B	protein	279	DROSOPHILA MELANOGASTER, EPTATRETUS BURGERI	P08953 (AlphaFold model), Q4G1L2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4ARR_1 TOLL RECEPTOR, VARIABLE LYMPHOCYTE RECEPTOR B.61 CHIMERA (chains A, B)
SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDY
QQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLD
RLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSN
KLRQMPRGIFGKMPKLKQLNLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYL
SRWLNKNSQKEQGSAKCSGSGKPVRSIICPTTGENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3
I3C	5-amino-2,4,6-triiodobenzene-1,3-dicarboxylic acid	C8 H4 I3 N O4	2

Primary citation

Liesegang-Like Patterns of Toll Crystals Grown in Gel. Gangloff, M., Moreno, A., Gay, N.J. J Appl Crystallogr (2013) 46:337. DOI 10.1107/S0021889812051606 · PubMed

Other PDB entries of the same protein (UniProt P08953 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LXR 2.2 Å, Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and…
4BV4 2.35 Å, Structure and allostery in Toll-Spatzle recognition
4ARN 2.41 Å, Crystal structure of the N-terminal domain of Drosophila Toll receptor
4LXS 3.3 Å, Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and…

Browse structure collections

About this viewer

MolViewer shows 4ARR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.