4B18: Human Importin alpha 5 with TERT NLS peptide

The crystal structure of human Importin alpha 5 with TERT NLS peptide. Determined by X-ray diffraction at 2.52 Å resolution. Released 4 Sept 2013.

Method: X-ray diffraction
Resolution: 2.52 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,464
Mol. weight: 51.68 kDa
Released: 4 Sept 2013

Explore 4B18 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4B18 contains 35 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 0 β-strands

Element	Residues	Length
α-helix	85-91	7
α-helix	96-111	16
α-helix	118-122	5
α-helix	127-134	8
α-helix	141-154	14
α-helix	159-167	9
α-helix	170-177	8
α-helix	183-197	15
α-helix	201-209	9
α-helix	213-218	6
α-helix	219-221	3
α-helix	226-240	15
α-helix	246-248	3
α-helix	249-252	4
α-helix	253-255	3
α-helix	256-262	7
α-helix	268-281	14
α-helix	286-294	9
α-helix	298-304	7
α-helix	310-323	14
α-helix	328-336	9
α-helix	339-346	8
α-helix	352-365	14
α-helix	370-378	9
α-helix	381-391	11
α-helix	394-410	17
α-helix	413-422	10
α-helix	425-430	6
α-helix	431-433	3
α-helix	437-460	24
α-helix	467-474	8
α-helix	477-483	7
α-helix	484-486	3
α-helix	490-503	14

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	238-240	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-1	A	protein	447	HOMO SAPIENS	P52294 (AlphaFold model)
Telomerase reverse transcriptase	B	protein	20	HOMO SAPIENS	O14746 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4B18_1 IMPORTIN SUBUNIT ALPHA-1 (chains A)
GFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTP
GVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDV
QEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSP
PPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELL
MHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNI
TAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCI
KPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQ
SHENQEIYQKAFDLIEHYFGTEDEDSS

Sequence of entity 2 (B), FASTA

>4B18_2 TELOMERASE REVERSE TRANSCRIPTASE (chains B)
RRRGGSASRSLPLPKRPRRA

Primary citation

Akt-Mediated Phosphorylation Increases the Binding Affinity of Htert for Importin Alpha to Promote Nuclear Translocation. Jeong, S.A., Kim, K., Lee, J.H. et al. J Cell Sci (2015) 128:2287. DOI 10.1242/JCS.166132 · PubMed

Other PDB entries of the same protein (UniProt P52294 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2JDQ 2.2 Å, C-terminal domain of influenza A virus polymerase PB2 subunit in complex with human…
3TJ3 2.7 Å, Structure of importin a5 bound to the N-terminus of Nup50
6WX9 2.8 Å, SOX2 bound to Importin-alpha 5

Browse structure collections

About this viewer

MolViewer shows 4B18 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.