Structure of the apo-rFnBPA(189-505) from Staphylococcus aureus. Determined by X-ray diffraction at 2.2 Å resolution. Released 9 Oct 2013.
Explore 4B5Z in 3D Show helices and sheets RCSB PDB PDBe
4B5Z contains 11 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 196 | 1 | 1 |
| α-helix | 198-200 | 3 | |
| β-strand | 201-209 | 9 | 2 |
| α-helix | 211-213 | 3 | |
| β-strand | 216-217 | 2 | 1 |
| α-helix | 219-221 | 3 | |
| β-strand | 225-233 | 9 | 2 |
| β-strand | 242-247 | 6 | 1 |
| β-strand | 251-252 | 2 | 3 |
| β-strand | 257 | 1 | 4 |
| β-strand | 261 | 1 | 1 |
| α-helix | 263-264 | 2 | |
| β-strand | 265-267 | 3 | 1 |
| β-strand | 270-279 | 10 | 1 |
| β-strand | 282-287 | 6 | 1 |
| α-helix | 289-291 | 3 | |
| β-strand | 298-305 | 8 | 2 |
| β-strand | 306-307 | 2 | 3 |
| α-helix | 308 | 1 | |
| β-strand | 316-324 | 9 | 1 |
| β-strand | 327-335 | 9 | 1 |
| β-strand | 341-342 | 2 | 4 |
| β-strand | 346-356 | 11 | 4 |
| α-helix | 357-359 | 3 | |
| β-strand | 361-370 | 10 | 4 |
| β-strand | 376-386 | 11 | 5 |
| α-helix | 393-395 | 3 | |
| β-strand | 396-402 | 7 | 4 |
| α-helix | 406-408 | 3 | |
| β-strand | 423-425 | 3 | 4 |
| α-helix | 427-430 | 4 | |
| α-helix | 431-433 | 3 | |
| β-strand | 434-436 | 3 | 5 |
| β-strand | 442-449 | 8 | 5 |
| β-strand | 453-460 | 8 | 4 |
| β-strand | 467-477 | 11 | 5 |
| β-strand | 490-499 | 10 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fibronectin-binding protein A | A | protein | 321 | STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325 | P14738 (AlphaFold model) |
>4B5Z_1 FIBRONECTIN-BINDING PROTEIN A (chains A) GPAMAKVETGTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFD FTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEIN LFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSH VAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFK EVTSNMSGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEQLYKY YYDRGYTLTWDNGLVLYSNKA
Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa). Stemberk, V., Jones, R.P., Moroz, O. et al. J Biol Chem (2014) 289:12842. DOI 10.1074/JBC.M113.543546 · PubMed
Other PDB entries of the same protein (UniProt P14738 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4B5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.