2RKY: Fourth and fifth fibronectin F1 modules

Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-1. Determined by X-ray diffraction at 1.8 Å resolution. Released 5 Aug 2008.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,025
Mol. weight: 26.91 kDa
Ligands: SCN
Released: 5 Aug 2008

Explore 2RKY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RKY contains 2 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	154-157	4	1
β-strand	162-165	4	1
β-strand	169-174	6	2
β-strand	178-186	9	2
β-strand	191-195	5	2
β-strand	199-202	4	3
β-strand	207-210	4	3
β-strand	214-218	5	4
β-strand	224-231	8	4
β-strand	236-240	5	4

Chain B: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	510-511	2	2
α-helix	512-513	2
β-strand	514-519	6	4
β-strand	521-524	4	6

Chain C: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	154-157	4	5
β-strand	162-165	4	5
β-strand	169-174	6	6
β-strand	178-186	9	6
β-strand	191-195	5	6
β-strand	199-202	4	7
β-strand	207-210	4	7
β-strand	214-218	5	4
β-strand	224-231	8	4
β-strand	236-242	7	4

Chain D: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	511	1	6
α-helix	512-513	2
β-strand	514-519	6	4
β-strand	521-524	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin	A, C	protein	93	Homo sapiens	P02751 (AlphaFold model)
Fibronectin-binding protein	B, D	protein	23		P14738 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2RKY_1 Fibronectin (chains A, C)
AEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRI
GDTWSKKDNRGNLLQCICTGNGRGEWKCERHTS

Sequence of entity 2 (B, D), FASTA

>2RKY_2 Fibronectin-binding protein (chains B, D)
NEKNGPIIQNNKFEYKEDTIKET

Ligands and cofactors

ID	Name	Formula	Copies
SCN	Thiocyanate ion	C N S	5

Water and common crystallization additives (K) are not listed.

Primary citation

Crystal structures of fibronectin-binding sites from Staphylococcus aureus FnBPA in complex with fibronectin domains. Bingham, R.J., Meenan, N.A., Schwarz-Linek, U. et al. Proc Natl Acad Sci U S A (2008) 105:12254-12258. DOI 10.1073/pnas.0803556105 · PubMed

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CG7 1.2 Å, Second and third fibronectin type I module pair (crystal form II).
4LXO 1.42 Å, Crystal structure of 9,10Fn3-elegantin chimera
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
3ZRZ 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
6MFA 1.75 Å, Fragment of human fibronectin containing the 4th-7th type III domains
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
1FNF 2.0 Å, Fragment of human fibronectin encompassing type-III repeats 7 through 10

Browse structure collections

About this viewer

MolViewer shows 2RKY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.