4B7Y: MSL1-MSL2 complex

Crystal structure of the MSL1-MSL2 complex. Determined by X-ray diffraction at 3.25 Å resolution. Released 6 Feb 2013.

Method: X-ray diffraction
Resolution: 3.25 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 2,264
Mol. weight: 36.39 kDa
Ligands: ZN
Released: 6 Feb 2013

Explore 4B7Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4B7Y contains 10 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	215-250	36

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	216-249	34

Chain C: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-18	15
α-helix	25-40	16
β-strand	43	1	1
β-strand	50	1	1
β-strand	55	1	2
β-strand	66	1	2
α-helix	68-70	3
α-helix	80-81	2
α-helix	94-114	21

Chain D: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-18	15
α-helix	26-41	16
β-strand	43	1	3
β-strand	50	1	3
β-strand	55	1	4
β-strand	66	1	4
α-helix	94-112	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Male-specific lethal 1 homolog	A, B	protein	44	HOMO SAPIENS	Q68DK7 (AlphaFold model)
Male-specific lethal 2 homolog	C, D	protein	116	HOMO SAPIENS	Q9HCI7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4B7Y_1 MALE-SPECIFIC LETHAL 1 HOMOLOG (chains A, B)
GAMGSGASSQAACLKQILLLQLDLIEQQQQQLQAKEKEIEELKS

Sequence of entity 2 (C, D), FASTA

>4B7Y_2 MALE-SPECIFIC LETHAL 2 HOMOLOG (chains C, D)
MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNS
TCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTLA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila. Hallacli, E., Lipp, M., Georgiev, P. et al. Mol Cell (2012) 48:587. DOI 10.1016/J.MOLCEL.2012.09.014 · PubMed

Other PDB entries of the same protein (UniProt Q68DK7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DNC 2.05 Å, Crystal structure of human MOF in complex with MSL1
4B86 3.5 Å, Crystal structure of the MSL1-MSL2 complex (3.5A)

Browse structure collections

About this viewer

MolViewer shows 4B7Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.