4DNC: Human MOF

Crystal structure of human MOF in complex with MSL1. Determined by X-ray diffraction at 2.05 Å resolution. Released 25 Jul 2012.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,372
Mol. weight: 79.63 kDa
Ligands: ZN
Released: 25 Jul 2012

Explore 4DNC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DNC contains 28 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	181-184	4	1
β-strand	187-190	4	1
α-helix	201-203	3
β-strand	206-209	4	1
β-strand	216-217	2	1
α-helix	220-229	10
β-strand	238-243	6	2
β-strand	246-252	7	2
α-helix	257-268	12
β-strand	283-291	9	2
β-strand	296-305	10	2
β-strand	312-314	3	3
β-strand	317-319	3	2
α-helix	321-323	3
α-helix	328-342	15
β-strand	347	1	4
β-strand	348-349	2	3
α-helix	350	1
α-helix	352	1
α-helix	355-375	21
α-helix	382-389	8
β-strand	391	1	4
α-helix	393-402	10
β-strand	406-409	4	5
β-strand	412-415	4	5
α-helix	419-427	9
α-helix	440-442	3
β-strand	443	1	2

Chain B: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	181-184	4	6
β-strand	187-190	4	6
α-helix	199-203	5
β-strand	206-209	4	6
β-strand	216-217	2	6
α-helix	220-229	10
β-strand	238-243	6	7
β-strand	246-252	7	7
α-helix	257-268	12
β-strand	283-292	10	7
β-strand	295-305	11	7
β-strand	312-314	3	8
β-strand	317-319	3	7
α-helix	321-323	3
α-helix	328-342	15
β-strand	347	1	9
β-strand	348-349	2	8
α-helix	350	1
α-helix	352	1
α-helix	355-375	21
α-helix	382-389	8
β-strand	391	1	9
α-helix	393-402	10
β-strand	406-407	2	10
β-strand	414-415	2	10
α-helix	419-427	9
α-helix	429-431	3
α-helix	432-434	3
α-helix	440-442	3
β-strand	443	1	7

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	478-480	3	1
α-helix	546-564	19

Chain E: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	478-480	3	6
α-helix	546-563	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase KAT8	A, B	protein	289	Homo sapiens	Q9H7Z6 (AlphaFold model)
Male-specific lethal 1 homolog	D, E	protein	48	Homo sapiens	Q68DK7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4DNC_1 Histone acetyltransferase KAT8 (chains A, B)
HEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQ
CQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILT
EVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSP
EKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYW
KGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK

Sequence of entity 2 (D, E), FASTA

>4DNC_2 Male-specific lethal 1 homolog (chains D, E)
LAVPSWRDHSVEPLRDPNPSDLLENLDDSVFSKRHAKLELDEKRRKRW

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural insight into the regulation of MOF in the male-specific lethal complex and the non-specific lethal complex. Huang, J., Wan, B., Wu, L. et al. Cell Res (2012) 22:1078-1081. DOI 10.1038/cr.2012.72 · PubMed

Other PDB entries of the same protein (UniProt Q9H7Z6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

29UU 1.3 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor example-41
9OOA 1.39 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 7
29UT 1.4 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor compound 2
2PQ8 1.45 Å, MYST histone acetyltransferase 1
9OOF 1.68 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 10e
29TM 1.7 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor bay-7728
6OIN 1.7 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor CTX-124143
6OIO 1.7 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 60
6OIQ 1.75 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 63
6OWI 1.75 Å, Crystal structure of MYST acetyltransferase domain in complex with inhibitor 85
5WCI 1.78 Å, Human MYST histone acetyltransferase 1
29TN 1.8 Å, KAT8 mutant (KAT6A surrogate, myst-cryst) in complex with KAT6A inhibitor compound 38

Browse structure collections

About this viewer

MolViewer shows 4DNC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.