4BG0: Complement regulator-acquiring surface protein 2

Crystal structure of complement factors H and FHL-1 binding protein BBH06 or CRASP-2 from Borrelia burgdorferi. Determined by X-ray diffraction at 2.1 Å resolution. Released 9 Apr 2014.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: BORRELIA BURGDORFERI
Chains: 1
Atoms: 1,740
Mol. weight: 25.05 kDa
Released: 9 Apr 2014

Explore 4BG0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BG0 contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	6-21	16
α-helix	25-45	21
α-helix	54-65	12
α-helix	66-68	3
α-helix	69-80	12
α-helix	89-105	17
α-helix	112-137	26
α-helix	143-162	20
α-helix	164-179	16
α-helix	183-185	3
α-helix	197-215	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement regulator-acquiring surface protein 2 (crasp-2 (crasp-2)	A	protein	218	BORRELIA BURGDORFERI	O50665 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BG0_1 COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2 (CRASP-2) (chains A)
GAMGRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSEGTFSDQSKVNQAI
SIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNDVSNARHVADSYKKL
RKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALECIVKTIGDMVND
REINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTLL

Primary citation

Structural Characterization of Cspz, a Complement Regulator Factor H and Fhl-1 Binding Protein from Borrelia Burgdorferi. Brangulis, K., Petrovskis, I., Kazaks, A. et al. FEBS J (2014) 281:2613. DOI 10.1111/FEBS.12808 · PubMed

Other PDB entries of the same protein (UniProt O50665 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ATG 1.8 Å, Insights to complement factor H recruitment by the borrelial CspZ protein as revealed by…
4CBE 1.83 Å, Crystal structure of complement factors H and FHL-1 binding protein BBH06 or CRASP-2…
9F1V 1.9 Å, Crystal structure of Borrelia burgdorferi CspZ-YA
9F21 1.95 Å, Crystal structure of Borrelia burgdorferi CspZ-YACS
9F7I 2.85 Å, Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7

Browse structure collections

About this viewer

MolViewer shows 4BG0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.