9F7I: Borrelia burgdorferi B31 CspZ

Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7. Determined by X-ray diffraction at 2.85 Å resolution. Released 25 Dec 2024.

Method: X-ray diffraction
Resolution: 2.85 Å
Organisms: Borreliella burgdorferi B31, Homo sapiens
Chains: 2
Atoms: 2,743
Mol. weight: 39.69 kDa
Ligands: ZN
Released: 25 Dec 2024

Explore 9F7I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9F7I contains 14 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-20	17
α-helix	24-45	22
α-helix	53-64	12
α-helix	65-67	3
α-helix	68-81	14
α-helix	88-100	13
α-helix	102-103	2
α-helix	107-137	31
α-helix	142-161	20
α-helix	163-177	15
α-helix	182-184	3
α-helix	196-214	19
α-helix	215-217	3

Chain B: 1 helix, 18 β-strands

Element	Residues	Length	Sheet
β-strand	13-15	3	1
β-strand	29	1	2
β-strand	31	1	2
β-strand	32-37	6	1
β-strand	41-42	2	3
β-strand	49-53	5	1
β-strand	54	1	4
β-strand	59	1	4
β-strand	66-67	2	3
β-strand	68-70	3	5
α-helix	71-73	3
β-strand	77	1	6
β-strand	85-87	3	5
β-strand	91-93	3	7
β-strand	96	1	6
β-strand	101	1	8
β-strand	108-112	5	7
β-strand	115-117	3	7
β-strand	123	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement regulator-acquiring surface protein 2 (CRASP-2)	A	protein	218	Borreliella burgdorferi B31	O50665 (AlphaFold model)
Complement factor H	B	protein	124	Homo sapiens	P08603 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9F7I_1 Complement regulator-acquiring surface protein 2 (CRASP-2) (chains A)
GAMGRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSEGTFSDQSKVNQAI
SIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNDVSNARHVADSYKKL
RKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALECIVKTIGDMVND
REINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTLL

Sequence of entity 2 (B), FASTA

>9F7I_2 Complement factor H (chains B)
TLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWS
PAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTP
RCIR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7. Brangulis, K., Surth, V., Marcinkiewicz, A.L. et al. To be published.

Other PDB entries of the same protein (UniProt O50665 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ATG 1.8 Å, Insights to complement factor H recruitment by the borrelial CspZ protein as revealed by…
4CBE 1.83 Å, Crystal structure of complement factors H and FHL-1 binding protein BBH06 or CRASP-2…
9F1V 1.9 Å, Crystal structure of Borrelia burgdorferi CspZ-YA
9F21 1.95 Å, Crystal structure of Borrelia burgdorferi CspZ-YACS
4BG0 2.1 Å, Crystal structure of complement factors H and FHL-1 binding protein BBH06 or CRASP-2…

Browse structure collections

About this viewer

MolViewer shows 9F7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.