9F21: Borrelia burgdorferi CspZ-YACS

Crystal structure of Borrelia burgdorferi CspZ-YACS. Determined by X-ray diffraction at 1.95 Å resolution. Released 16 Apr 2025.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Borreliella burgdorferi B31
Chains: 1
Atoms: 1,927
Mol. weight: 25.35 kDa
Released: 16 Apr 2025

Explore 9F21 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9F21 contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	22-38	17
α-helix	42-63	22
α-helix	71-82	12
α-helix	83-85	3
α-helix	86-97	12
α-helix	107-119	13
α-helix	125-154	30
α-helix	160-179	20
α-helix	181-196	16
α-helix	199-202	4
α-helix	211-233	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement regulator-acquiring surface protein 2 (CRASP-2)	A	protein	221	Borreliella burgdorferi B31	O50665 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9F21_1 Complement regulator-acquiring surface protein 2 (CRASP-2) (chains A)
GAMGDVSRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSEGTFSDQSKVN
QAISIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNDVSNARHVADSY
KKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALESIVKTIGDM
VNDREINSRSRANNFAKKEADFLGAAVELEGAYKAIKQTLL

Primary citation

Mechanistic insights into the structure-based design of a CspZ-targeting Lyme disease vaccine. Brangulis, K., Malfetano, J., Marcinkiewicz, A.L. et al. Nat Commun (2025) 16:2898-2898. DOI 10.1038/s41467-025-58182-x · PubMed

Other PDB entries of the same protein (UniProt O50665 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ATG 1.8 Å, Insights to complement factor H recruitment by the borrelial CspZ protein as revealed by…
4CBE 1.83 Å, Crystal structure of complement factors H and FHL-1 binding protein BBH06 or CRASP-2…
9F1V 1.9 Å, Crystal structure of Borrelia burgdorferi CspZ-YA
4BG0 2.1 Å, Crystal structure of complement factors H and FHL-1 binding protein BBH06 or CRASP-2…
9F7I 2.85 Å, Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7

Browse structure collections

About this viewer

MolViewer shows 9F21 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.