4BPK: Bcl-xL

Bcl-xL bound to alpha beta Puma BH3 peptide 5. Determined by X-ray diffraction at 1.76 Å resolution. Released 9 Apr 2014.

Method: X-ray diffraction
Resolution: 1.76 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 2,987
Mol. weight: 42.48 kDa
Ligands: CD
Released: 9 Apr 2014

Explore 4BPK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BPK contains 19 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	2-19	18
α-helix	26-100	19
α-helix	102-109	8
α-helix	119-130	12
α-helix	137-156	20
α-helix	161-177	17
α-helix	179-184	6
α-helix	188-194	7

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	3-18	16
α-helix	26-100	19
α-helix	102-109	8
α-helix	119-130	12
α-helix	137-156	20
α-helix	161-173	13
α-helix	174-178	5
α-helix	179-184	6
α-helix	187-194	8

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-like protein 1	A, B	protein	157	HOMO SAPIENS	Q07817 (AlphaFold model)
Alpha beta BH3-peptide	C, D	protein	22	HOMO SAPIENS	Q9BXH1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4BPK_1 BCL-2-LIKE PROTEIN 1 (chains A, B)
GPLGMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQL
HITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMAT
YLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQER

Sequence of entity 2 (C, D), FASTA

>4BPK_2 ALPHA BETA BH3-PEPTIDE (chains C, D)
XWAREIGAXARRMADDLNAQYX

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	15

Water and common crystallization additives (EDO) are not listed.

Primary citation

Structure-Guided Rational Design of Alpha/Beta-Peptide Foldamers with High Affinity for Bcl-2 Family Prosurvival Proteins. Smith, B.J., Lee, E.F., Checco, J.W. et al. Chembiochem (2013) 14:1564. DOI 10.1002/CBIC.201300351 · PubMed

Other PDB entries of the same protein (UniProt Q07817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JGW 1.3 Å, Crystal structure of BCL-XL in complex with COMPOUND 1620116, CRYSTAL FORM 1
3SP7 1.4 Å, Crystal Structure of Bcl-xL bound to BM903
7YAA 1.4 Å, Crystal structure analysis of cp3 bound BCLxl
7LH7 1.41 Å, Crystal structure of BCL-XL in complex with a benzothiazole-based inhibitor
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
4QVF 1.53 Å, Crystal structure of Bcl-xL in complex with BIM BH3 domain
4A1U 1.54 Å, Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL
6VWC 1.6 Å, Crystal structure of Bcl-xL in complex with tetrahydroisoquinoline-pyridine based…
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
3SPF 1.7 Å, Crystal Structure of Bcl-xL bound to BM501
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2

Browse structure collections

About this viewer

MolViewer shows 4BPK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.