4BS1: Transcriptional regulator

MuB is an AAAplus ATPase that forms helical filaments to control target selection for DNA transposition. Determined by electron microscopy at 18.0 Å resolution. Released 3 Jul 2013.

Method: Electron microscopy
Resolution: 18.0 Å
Organism: ENTEROBACTERIA PHAGE MU
Chains: 2
Atoms: 2,023
Mol. weight: 28.81 kDa
Ligands: ADP
Released: 3 Jul 2013

Explore 4BS1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BS1 contains 12 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	314-331	18
β-strand	338-339	2	1
α-helix	341-349	9
α-helix	356-369	14
β-strand	374-375	2	1
α-helix	377-381	5

Chain B: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	144-156	13
β-strand	163-166	4	2
α-helix	173-183	11
β-strand	191-195	5	2
α-helix	204-207	4
β-strand	211	1	3
β-strand	223	1	3
α-helix	226-229	4
β-strand	234-238	5	2
α-helix	240-242	3
α-helix	245-256	12
β-strand	259-260	2	4
β-strand	269-270	2	4
β-strand	274-279	6	2
α-helix	283-289	7
α-helix	294-300	7
β-strand	303-306	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional regulator (ntrc family)	A	protein	73	ENTEROBACTERIA PHAGE MU	O67198 (AlphaFold model)
Transcriptional regulator (ntrc family)	B	protein	173	ENTEROBACTERIA PHAGE MU	O67198 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BS1_1 TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) (chains A)
ERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSE
GKFIDRGELSCLV

Sequence of entity 2 (B), FASTA

>4BS1_2 TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) (chains B)
EEYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNV
ASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIE
SGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPP

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Mub is an Aaa+ ATPase that Forms Helical Filaments to Control Target Selection for DNA Transposition. Mizuno, N., Dramicanin, M., Mizuuchi, M. et al. Proc Natl Acad Sci U S A (2013) 110:E2441. DOI 10.1073/PNAS.1309499110 · PubMed

Other PDB entries of the same protein (UniProt O67198 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4L5E 1.34 Å, Crystal structure of A. aeolicus NtrC1 DNA binding domain
4L4U 2.2 Å, Crystal structure of construct containing A. aeolicus NtrC1 receiver, central and DNA…
1NY5 2.4 Å, Crystal structure of sigm54 activator (AAA+ ATPase) in the inactive state
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…
3M0E 2.63 Å, Crystal structure of the ATP-bound state of Walker B mutant of NtrC1 ATPase domain
9MSE 2.7 Å, de novo SigN RNA polymerase transcription initiation intermediate with pre-catalytic…
9MSG 2.7 Å, De novo SigN RNA polymerase transcription initiation intermediate with bound SigN-RII
1ZY2 3.03 Å, Crystal structure of the phosphorylated receiver domain of the transcription regulator…
1NY6 3.1 Å, Crystal structure of sigm54 activator (AAA+ ATPase) in the active state
4LZZ 3.21 Å, Nucleotide-induced asymmetry within atpase activator ring drives s54-RNAP interaction…
4LY6 3.6 Å, Nucleotide-induced asymmetry within ATPase activator ring drives s54-RNAP interaction…
4BT1 16.0 Å, MuB is an AAAplus ATPase that forms helical filaments to control target selection for…

Browse structure collections

About this viewer

MolViewer shows 4BS1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.