Crystal structure of R-spondin 1 (Fu1Fu2) - Native. Determined by X-ray diffraction at 2.2 Å resolution. Released 19 Jun 2013.
Explore 4BSO in 3D Show helices and sheets RCSB PDB PDBe
4BSO contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14-18 | 5 | 1 |
| β-strand | 22-26 | 5 | 1 |
| β-strand | 31-35 | 5 | 1 |
| β-strand | 42-46 | 5 | 1 |
| α-helix | 49-50 | 2 | |
| β-strand | 53-56 | 4 | 1 |
| β-strand | 62-66 | 5 | 1 |
| β-strand | 72-77 | 6 | 2 |
| β-strand | 80-84 | 5 | 2 |
| α-helix | 85 | 1 | |
| β-strand | 89-91 | 3 | 3 |
| β-strand | 94-96 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| R-spondin-1 | A | protein | 126 | HOMO SAPIENS | Q2MKA7 (AlphaFold model) |
>4BSO_1 R-SPONDIN-1 (chains A) GSRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARN PDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAAA HHHHHH
Structure of Stem Cell Growth Factor R-Spondin 1 in Complex with the Ectodomain of its Receptor Lgr5. Peng, W.C., De Lau, W., Forneris, F. et al. Cell Rep (2013) 3:1885. DOI 10.1016/J.CELREP.2013.06.009 · PubMed
Other PDB entries of the same protein (UniProt Q2MKA7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4BSO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.