4C29: Von willebrand factor

Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation. Determined by X-ray diffraction at 2.2 Å resolution. Released 8 Jan 2014.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,444
Mol. weight: 50.02 kDa
Ligands: CA
Released: 8 Jan 2014

Explore 4C29 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4C29 contains 28 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1274	1	1
β-strand	1276-1283	8	2
β-strand	1285	1	3
α-helix	1290-1305	16
β-strand	1309	1	2
β-strand	1314-1321	8	2
β-strand	1325-1329	5	2
α-helix	1337-1345	9
α-helix	1347-1349	3
β-strand	1352	1	3
α-helix	1357-1363	7
α-helix	1364-1368	5
β-strand	1378-1385	8	2
α-helix	1391-1394	4
α-helix	1397-1406	10
β-strand	1409-1416	8	2
α-helix	1422-1429	8
α-helix	1433-1435	3
α-helix	1436-1437	2
β-strand	1438-1440	3	2
α-helix	1443-1445	3
α-helix	1446-1460	15
α-helix	1462	1
β-strand	1463	1	1
α-helix	1464-1465	2

Chain B: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1274	1	4
β-strand	1276-1283	8	5
β-strand	1285	1	6
α-helix	1290-1305	16
β-strand	1309	1	5
β-strand	1314-1321	8	5
β-strand	1325-1329	5	5
α-helix	1337-1345	9
α-helix	1347-1349	3
β-strand	1352	1	6
α-helix	1357-1363	7
α-helix	1364-1368	5
β-strand	1378-1385	8	5
α-helix	1391-1393	3
α-helix	1397-1406	10
β-strand	1409-1416	8	5
α-helix	1422-1429	8
α-helix	1433-1435	3
α-helix	1436-1437	2
β-strand	1438-1440	3	5
α-helix	1443-1445	3
α-helix	1450-1460	11
α-helix	1462	1
β-strand	1463	1	4
α-helix	1464-1465	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Von willebrand factor	A, B	protein	215	HOMO SAPIENS	P04275 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4C29_1 VON WILLEBRAND FACTOR (chains A, B)
MEPPLHDFCRSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYH
DGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIAL
LLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSS
VDELEQQRDEIVSYLCDLAPEAPPPTLPPHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Water and common crystallization additives (PEG, ACT) are not listed.

Primary citation

Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib. Blenner, M.A., Dong, X., Springer, T.A. J Biol Chem (2014) 289:5565. DOI 10.1074/JBC.M113.511220 · PubMed

Other PDB entries of the same protein (UniProt P04275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BV8 1.59 Å, G1324S mutation in von Willebrand Factor A1 domain
7EOW 1.6 Å, High-resolution structure of vWF A1 domain in complex with caplacizumab, the first…
3ZQK 1.7 Å, Von Willebrand Factor A2 domain with calcium
1ATZ 1.8 Å, Human von willebrand factor A3 domain
1IJB 1.8 Å, The von Willebrand Factor mutant (I546V) A1 domain
2ADF 1.9 Å, Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody…
3GXB 1.9 Å, Crystal structure of VWF A2 domain
3PPV 1.9 Å, Crystal structure of an engineered VWF A2 domain (N1493C and C1670S)
3PPW 1.9 Å, Crystal structure of the D1596A mutant of an engineered VWF A2 domain (N1493C and C1670S)
3PPX 1.91 Å, Crystal structure of the N1602A mutant of an engineered VWF A2 domain (N1493C and C1670S)
1FNS 2.0 Å, Crystal structure of the von willebrand factor (VWF) A1 domain I546V mutant in complex…
3PPY 2.0 Å, Crystal structure of the D1596A/N1602A double mutant of an engineered VWF A2 domain…

Browse structure collections

About this viewer

MolViewer shows 4C29 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.