Crystal structure of Siah1 at 1.95 A resolution. Determined by X-ray diffraction at 1.95 Å resolution. Released 16 Oct 2013.
Explore 4C9Z in 3D Show helices and sheets RCSB PDB PDBe
4C9Z contains 14 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 92-95 | 4 | |
| β-strand | 96-97 | 2 | 1 |
| β-strand | 108-109 | 2 | 1 |
| α-helix | 111-118 | 8 | |
| β-strand | 126-127 | 2 | 2 |
| β-strand | 138-139 | 2 | 2 |
| α-helix | 141-151 | 11 | |
| β-strand | 156-159 | 4 | 3 |
| β-strand | 162-167 | 6 | 4 |
| β-strand | 177-184 | 8 | 3 |
| β-strand | 187-199 | 13 | 3 |
| β-strand | 202-211 | 10 | 3 |
| α-helix | 215-218 | 4 | |
| β-strand | 221-229 | 9 | 4 |
| β-strand | 232-238 | 7 | 4 |
| α-helix | 239-240 | 2 | |
| β-strand | 241-242 | 2 | 3 |
| α-helix | 248-252 | 5 | |
| β-strand | 257-260 | 4 | 3 |
| α-helix | 261-267 | 7 | |
| β-strand | 268-269 | 2 | 4 |
| β-strand | 272-281 | 10 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 96-97 | 2 | 5 |
| α-helix | 101-103 | 3 | |
| β-strand | 108-109 | 2 | 5 |
| α-helix | 111-120 | 10 | |
| β-strand | 126-127 | 2 | 6 |
| β-strand | 138-139 | 2 | 6 |
| α-helix | 141-151 | 11 | |
| β-strand | 157-159 | 3 | 7 |
| β-strand | 162-167 | 6 | 4 |
| β-strand | 176-184 | 9 | 7 |
| β-strand | 187-199 | 13 | 7 |
| β-strand | 202-211 | 10 | 7 |
| α-helix | 215-218 | 4 | |
| β-strand | 221-229 | 9 | 4 |
| β-strand | 232-238 | 7 | 4 |
| α-helix | 239-240 | 2 | |
| β-strand | 241-242 | 2 | 7 |
| α-helix | 248-252 | 5 | |
| β-strand | 257-260 | 4 | 7 |
| α-helix | 261-267 | 7 | |
| β-strand | 269 | 1 | 8 |
| β-strand | 272 | 1 | 8 |
| β-strand | 273-281 | 9 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase SIAH1 | A, B | protein | 195 | HOMO SAPIENS | Q8IUQ4 (AlphaFold model) |
>4C9Z_1 E3 UBIQUITIN-PROTEIN LIGASE SIAH1 (chains A, B) GHMANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPH LMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFA IVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLF AENGNLGINVTISMC
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Water and common crystallization additives (TRS, SO4, GOL, CL) are not listed.
Two High-Resolution Structures of the Human E3 Ubiquitin Ligase Siah1. Rimsa, V., Eadsforth, T.C., Hunter, W.N. Acta Crystallogr Sect F Struct Biol Cryst Commun (2013) 96:1339. DOI 10.1107/S1744309113031448 · PubMed
Other PDB entries of the same protein (UniProt Q8IUQ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4C9Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.