4CBW: Actin, alpha skeletal muscle, actin

Crystal structure of Plasmodium berghei actin I with D-loop from muscle actin. Determined by X-ray diffraction at 2.5 Å resolution. Released 30 Apr 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: PLASMODIUM BERGHEI, SYNTHETIC CONSTRUCT, MUS MUSCULUS
Chains: 2
Atoms: 3,956
Mol. weight: 56.87 kDa
Ligands: CA, DIO, ATP
Released: 30 Apr 2014

Explore 4CBW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CBW contains 33 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	7-8	2
β-strand	9-12	4	1
β-strand	17-22	6	1
β-strand	30-33	4	1
β-strand	36-39	4	2
β-strand	54-55	2	2
α-helix	57-60	4
α-helix	63-65	3
β-strand	66-69	4	2
β-strand	72-73	2	3
β-strand	76-77	2	3
α-helix	80-88	9
α-helix	89-95	7
α-helix	99-101	3
β-strand	104-108	5	1
α-helix	114-126	13
β-strand	132-137	6	1
α-helix	138-145	8
β-strand	151-156	6	4
β-strand	161-167	7	4
β-strand	170-171	2	4
α-helix	173-175	3
β-strand	177-179	3	4
α-helix	183-193	11
α-helix	194-197	4
α-helix	206-217	12
β-strand	219	1	5
α-helix	224-233	10
β-strand	239-242	4	6
β-strand	248-251	4	6
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-268	4
α-helix	272-274	3
α-helix	275-284	10
α-helix	288-290	3
α-helix	291-295	5
β-strand	298-301	4	4
α-helix	303-306	4
β-strand	308	1	5
α-helix	310-321	12
β-strand	330-331	2	4
α-helix	339-347	9
α-helix	353-355	3
β-strand	358-359	2	1
α-helix	360-366	7
α-helix	368-370	3
α-helix	371-374	4

Chain G: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	30-34	5
β-strand	40-46	7	7
β-strand	51-53	3	7
α-helix	54-55	2
α-helix	56-58	3
β-strand	61-63	3	8
β-strand	67-75	9	7
β-strand	81-89	9	7
α-helix	95-111	17
β-strand	116-122	7	7
α-helix	128-131	4
β-strand	139-141	3	8
α-helix	145-147	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin, alpha skeletal muscle, actin	A	protein	377	PLASMODIUM BERGHEI, SYNTHETIC CONSTRUCT	P68137 (AlphaFold model), Q4Z1L3 (AlphaFold model)
Gelsolin	G	protein	127	MUS MUSCULUS	P13020 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4CBW_1 ACTIN, ALPHA SKELETAL MUSCLE, ACTIN (chains A)
GAGDEEVQALVIDNGSGNVKAGVAGDDAPRSVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRER
MTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMRL
DLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIEK
SYELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNIV
LSGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWIT
KEEYDESGPSIVHRKCF

Sequence of entity 2 (G), FASTA

>4CBW_2 GELSOLIN (chains G)
GPMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQ
YDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKK
GGVASGF

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3
DIO	1,4-diethylene dioxide	C4 H8 O2	1
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

Structural Differences Explain Diverse Functions of Plasmodium Actins. Vahokoski, J., Bhargav, S.P., Desfosses, A. et al. PLoS Pathog (2014) 10:4091. DOI 10.1371/JOURNAL.PPAT.1004091 · PubMed

Other PDB entries of the same protein (UniProt P68137 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8EFH 3.3 Å, Helical reconstruction of the human cardiac actin-tropomyosin-myosin complex in complex…
8DD0 3.5 Å, The structure of the native cardiac thin filament junction region
7KO5 7.8 Å, Structure of cardiac native thin filament at pCa=5.8 having upper and lower troponins in…
7KOR 7.8 Å, Structure of cardiac native thin filament at pCa=5.8 having upper troponin in Ca2+ bound…
5NOL 8.0 Å, Ca2+-induced Movement of Tropomyosin on Native Cardiac Thin Filaments - "Closed" state
7KO4 8.0 Å, Structure of cardiac native thin filament at pCa=5.8 having upper and lower troponins in…
7TIJ 8.0 Å, Cardiac F-actin decorated with regulatory M-domain of cardiac myosin binding protein C
7TIT 8.0 Å, Cardiac thin filament decorated with regulatory M-domain of cardiac myosin binding…
7TJ7 8.0 Å, Cardiac thin filament decorated with C1 Ig-domain and regulatory M-domain of cardiac…
7KON 8.1 Å, Structure of upper Tn Ca2+ free (rotated) and lower Tn Ca2+ bound cardiac native thin…
7KO7 8.3 Å, Structure of the native cardiac thin filament at pCa=5.8 having upper Tn in Ca2+ free…
5NOG 11.0 Å, Ca2+-induced Movement of Tropomyosin on Native Cardiac Thin Filaments - "Blocked" state

Browse structure collections

About this viewer

MolViewer shows 4CBW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.