4CC3: Dynamin-binding protein

Complex of human Tuba C-terminal SH3 domain and Mena proline-rich peptide - H3. Determined by X-ray diffraction at 1.97 Å resolution. Released 30 Oct 2013.

Method: X-ray diffraction
Resolution: 1.97 Å
Organisms: HOMO SAPIENS, MUS MUSCULUS
Chains: 8
Atoms: 2,573
Mol. weight: 35.96 kDa
Ligands: PE4
Released: 30 Oct 2013

Explore 4CC3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CC3 contains 10 α-helices and 33 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and E: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1517-1520	4	1
β-strand	1524	1	2
β-strand	1531	1	1
β-strand	1534	1	2
β-strand	1539-1544	6	1
β-strand	1554-1559	6	1
β-strand	1562-1567	6	1
α-helix	1568-1570	3
β-strand	1571-1572	2	1

Chains B and H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5
α-helix	9-11	3

Chain F: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5
α-helix	8-9	2

Chain G: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1518-1520	3	7
β-strand	1524	1	8
β-strand	1531	1	9
β-strand	1534	1	8
β-strand	1539-1540	2	7
β-strand	1541-1544	4	9
β-strand	1554-1559	6	9
β-strand	1562-1567	6	9
α-helix	1568-1570	3
β-strand	1571-1573	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynamin-binding protein	A, C, E, G	protein	67	HOMO SAPIENS	Q6XZF7 (AlphaFold model)
Protein enabled homolog	B, D, F, H	protein	12	MUS MUSCULUS	Q03173 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>4CC3_1 DYNAMIN-BINDING PROTEIN (chains A, C, E, G)
GPEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNY
IRKTEYT

Sequence of entity 2 (B, D, F, H), FASTA

>4CC3_2 PROTEIN ENABLED HOMOLOG (chains B, D, F, H)
PPPPLPSGPAYA

Ligands and cofactors

ID	Name	Formula	Copies
PE4	2-{2-[2-(2-{2-[2-(2-ethoxy-ethoxy)-ethoxy]-ethoxy}-ethoxy)-ethoxy]-ethoxy}-etha…	C16 H34 O8	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading. Polle, L., Rigano, L.A., Julian, R. et al. Structure (2014) 22:304. DOI 10.1016/J.STR.2013.10.017 · PubMed

Other PDB entries of the same protein (UniProt Q6XZF7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CC2 1.55 Å, Complex of human Tuba C-terminal SH3 domain with human N-WASP proline- rich peptide -…
4GLM 1.9 Å, Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]
4CC7 1.97 Å, Crystal structure of the sixth or C-terminal SH3 domain of human Tuba in complex with…
4CC4 2.6 Å, Complex of InlC of Listeria monocytogenes and human Tuba C-terminal SH3 domain
1UG1 SH3 domain of Hypothetical protein BAA76854.1
1UHC Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]

Browse structure collections

About this viewer

MolViewer shows 4CC3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.