Crystal structure of VEGFR-1 domain 2 in presence of Cobalt. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Jan 2015.
Explore 4CL7 in 3D Show helices and sheets RCSB PDB PDBe
4CL7 contains 10 α-helices and 41 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 135 | 1 | 1 |
| α-helix | 143 | 1 | |
| β-strand | 144-148 | 5 | 2 |
| β-strand | 154-156 | 3 | 3 |
| β-strand | 160 | 1 | 1 |
| β-strand | 167-171 | 5 | 2 |
| β-strand | 175-177 | 3 | 2 |
| α-helix | 178-179 | 2 | |
| β-strand | 184-187 | 4 | 3 |
| β-strand | 191-194 | 4 | 3 |
| α-helix | 199-201 | 3 | |
| β-strand | 204-211 | 8 | 2 |
| β-strand | 214-224 | 11 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 135 | 1 | 4 |
| α-helix | 143 | 1 | |
| β-strand | 144-148 | 5 | 5 |
| β-strand | 154-156 | 3 | 6 |
| β-strand | 160 | 1 | 4 |
| β-strand | 167-171 | 5 | 5 |
| β-strand | 175-177 | 3 | 5 |
| β-strand | 184-187 | 4 | 6 |
| β-strand | 191-194 | 4 | 6 |
| α-helix | 199-201 | 3 | |
| β-strand | 203-211 | 9 | 5 |
| β-strand | 214-224 | 11 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 135 | 1 | 7 |
| α-helix | 143 | 1 | |
| β-strand | 144-148 | 5 | 8 |
| β-strand | 154-156 | 3 | 9 |
| β-strand | 160 | 1 | 7 |
| β-strand | 167-171 | 5 | 8 |
| β-strand | 175-177 | 3 | 8 |
| β-strand | 180 | 1 | 9 |
| β-strand | 184-187 | 4 | 9 |
| β-strand | 191-194 | 4 | 9 |
| α-helix | 199-201 | 3 | |
| β-strand | 203-211 | 9 | 8 |
| β-strand | 214-224 | 11 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 135 | 1 | 10 |
| α-helix | 143 | 1 | |
| β-strand | 144-148 | 5 | 11 |
| β-strand | 154-156 | 3 | 12 |
| β-strand | 160 | 1 | 10 |
| β-strand | 167-171 | 5 | 11 |
| β-strand | 175-177 | 3 | 11 |
| α-helix | 178-179 | 2 | |
| β-strand | 184-187 | 4 | 12 |
| β-strand | 191-194 | 4 | 12 |
| α-helix | 199-201 | 3 | |
| β-strand | 203-211 | 9 | 11 |
| β-strand | 214-224 | 11 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vascular endothelial growth factor receptor 1 | A, B, C, D | protein | 94 | HOMO SAPIENS | P17948 (AlphaFold model) |
>4CL7_1 VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1 (chains A, B, C, D) GRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKG FIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| CO | Cobalt (II) ion | Co | 5 |
Water and common crystallization additives (EDO) are not listed.
Biophysical Studies of the Induced Dimerization of Human Vegf R Receptor 1 Binding Domain by Divalent Metals Competing with Vegf-A. Gaucher, J.-F., Reille-Seroussi, M., Gagey-Eilstein, N. et al. PLoS One (2016) 11:67755. DOI 10.1371/JOURNAL.PONE.0167755 · PubMed
Other PDB entries of the same protein (UniProt P17948 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4CL7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.