4CPE: Wild-type streptavidin

Wild-type streptavidin in complex with love-hate ligand 1 (LH1). Determined by X-ray diffraction at 1.06 Å resolution. Released 6 Aug 2014.

Method: X-ray diffraction
Resolution: 1.06 Å
Organism: STREPTOMYCES AVIDINII
Chains: 2
Atoms: 2,165
Mol. weight: 27.65 kDa
Ligands: LUV
Released: 6 Aug 2014

Explore 4CPE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CPE contains 2 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	19-23	5	1
β-strand	28-33	6	1
β-strand	38-44	7	1
β-strand	54-60	7	1
β-strand	71-80	10	1
β-strand	85-97	13	1
β-strand	103-112	10	1
α-helix	116-121	6
β-strand	123-131	9	1

Chain B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	19-23	5	2
β-strand	28-33	6	2
β-strand	38-44	7	2
β-strand	54-60	7	2
β-strand	71-80	10	2
β-strand	85-97	13	2
β-strand	103-112	10	2
α-helix	116-121	6
β-strand	123-132	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Streptavidin	A, B	protein	127	STREPTOMYCES AVIDINII	P22629 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4CPE_1 STREPTAVIDIN (chains A, B)
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTA
LGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTK
VKPSAAS

Ligands and cofactors

ID	Name	Formula	Copies
LUV	(3aS,4S,6aR)-2-oxo-hexahydro-1H-thieno[3,4- d]imidazolidin-4-yl]-N-{2-[(2,6-…	C31 H34 N4 O3 S	2

Primary citation

Love-Hate Ligands for High Resolution Analysis of Strain in Ultra-Stable Protein/Small Molecule Interaction. Fairhead, M., Shen, D., Chan, L.K.M. et al. Bioorg Med Chem (2014) 22:5476. DOI 10.1016/J.BMC.2014.07.029 · PubMed

Other PDB entries of the same protein (UniProt P22629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F01 0.85 Å, Epi-biotin complex with core streptavidin
9PUA 0.94 Å, L-Biotin-streptavidin binding
3RY2 0.95 Å, Wild-type core streptavidin-biotin complex at atomic resolution
9PUB 0.95 Å, Biotin-streptavidin binding
1LUQ 0.96 Å, Full Matrix Error Analysis of Streptavidin
2GH7 1.0 Å, Epi-biotin complex with core streptavidin
3WYQ 1.0 Å, Crystal structure of the low-immunogenic core streptavidin mutant LISA-314…
4GDA 1.0 Å, Circular Permuted Streptavidin A50/N49
6T2L 1.0 Å, Streptavidin variants harbouring an artificial organocatalyst based cofactor
3RY1 1.03 Å, Wild-type core streptavidin at atomic resolution
5N8B 1.03 Å, Crystal structure of streptavidin with peptide afpdylaeyhgg
5N8J 1.05 Å, CRYSTAL STRUCTURE OF STREPTAVIDIN WITH PEPTIDE D-amino acid containing peptide…

Browse structure collections

About this viewer

MolViewer shows 4CPE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.