Creating novel F1 inhibitors through fragment based lead generation and structure aided drug design. Determined by X-ray diffraction at 1.6 Å resolution. Released 11 Feb 2015.
Explore 4CRC in 3D Show helices and sheets RCSB PDB PDBe
4CRC contains 11 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| β-strand | 30-35 | 6 | 3 |
| β-strand | 37D-46 | 10 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-59 | 4 | |
| α-helix | 62-64 | 3 | |
| β-strand | 65-68 | 4 | 3 |
| β-strand | 73 | 1 | 4 |
| α-helix | 74-76 | 3 | |
| β-strand | 83-90 | 8 | 3 |
| α-helix | 97-99 | 3 | |
| β-strand | 104-108 | 5 | 3 |
| β-strand | 115 | 1 | 5 |
| β-strand | 118 | 1 | 5 |
| α-helix | 121-122 | 2 | |
| β-strand | 123 | 1 | 2 |
| α-helix | 124-126 | 3 | |
| α-helix | 127-129 | 3 | |
| β-strand | 136-140 | 5 | 2 |
| β-strand | 154 | 1 | 4 |
| α-helix | 155 | 1 | |
| β-strand | 156-159 | 4 | 2 |
| β-strand | 162-163 | 2 | 2 |
| α-helix | 165-171 | 7 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-202A | 6 | 2 |
| β-strand | 202D-215 | 10 | 2 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-243 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulation factor XIa light chain | A | protein | 238 | Homo sapiens | P03951 (AlphaFold model) |
>4CRC_1 Coagulation factor XIa light chain (chains A) IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSG ILNQAEIAEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYADSQRPISLPSKGER NVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGG KDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV
| ID | Name | Formula | Copies |
|---|---|---|---|
| OTM | (2S)-2-[[(E)-3-[5-chloranyl-2-(1,2,3,4-tetrazol-1-yl)phenyl]prop-2-enoyl]amino]… | C26 H21 Cl N10 O2 | 1 |
Water and common crystallization additives (SO4) are not listed.
Creating Novel Activated Factor Xi Inhibitors Through Fragment Based Lead Generation and Structure Aided Drug Design. Fjellstrom, O., Akkaya, S., Beisel, H. et al. PLoS One (2015) 10:13705. DOI 10.1371/JOURNAL.PONE.0113705 · PubMed
Other PDB entries of the same protein (UniProt P03951 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4CRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.